| Product Number |
ARP32084_P050 |
| Product Page |
www.avivasysbio.com/nr2e1-antibody-n-terminal-region-arp32084-p050.html |
| Name |
NR2E1 Antibody - N-terminal region (ARP32084_P050) |
| Protein Size (# AA) |
385 amino acids |
| Molecular Weight |
43 kDa |
| NCBI Gene Id |
7101 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Nuclear receptor subfamily 2, group E, member 1 |
| Alias Symbols |
TLL, TLX, XTLL |
| Peptide Sequence |
Synthetic peptide located within the following region: MSKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Kumar,R.A., (er) Am. J. Med. Genet. B Neuropsychiatr. Genet. (2008) In press |
| Description of Target |
The NR2E1 gene is a member of the steroid nuclear receptor superfamily and is predominately expressed in the brain. The contributions of this gene to human B-cell leukemia and to brain development are unknown at present. |
| Protein Interactions |
NSD1; BCL11A; UBC; ERBB2IP; SP1; HDAC7; HDAC5; HDAC3; GSE1; RCOR1; KDM1A; ZMYM2; HDAC2; HDAC1; Gug; ATN1; RERE; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-NR2E1 (ARP32084_P050) antibody |
| Additional Information |
IHC Information: Human Brain, Cortex (formalin-fixed, paraffin-embedded) stained with NR2E1 antibody ARP32084_P050 followed by biotinylated goat anti-rabbit IgG secondary antibody LS-D1, alkaline phosphatase-streptavidin and chromogen.
IHC Information: Human Placenta (formalin-fixed, paraffin-embedded) stained with NR2E1 antibody ARP32084_P050 followed by biotinylated goat anti-rabbit IgG secondary antibody LS-D1, alkaline phosphatase-streptavidin and chromogen.
IHC Information: Human Prostate (formalin-fixed, paraffin-embedded) stained with NR2E1 antibody ARP32084_P050 followed by biotinylated goat anti-rabbit IgG secondary antibody LS-D1, alkaline phosphatase-streptavidin and chromogen. |
| Application Info |
IHC Information: Colon, myenteric plexus |
| Blocking Peptide |
For anti-NR2E1 (ARP32084_P050) antibody is Catalog # AAP32084 (Previous Catalog # AAPP03001) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human NR2E1 |
| Uniprot ID |
Q9Y466 |
| Protein Name |
Nuclear receptor subfamily 2 group E member 1 |
| Protein Accession # |
NP_003260 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_003269 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
NR2E1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Human Fetal Muscle
 | WB Suggested Anti-NR2E1 Antibody Titration: 1 ug/ml
Positive Control: Fetal Muscle cell lysate |
|
| Image 2 | Human Prostate
 | Human Prostate |
|
| Image 3 | Human Placenta
 | Human Placenta |
|
| Image 4 | Human Brain
 | Human Brain |
|
| Image 5 | Human Lung Tumor
 | Host: Rabbit
Target Name: NR2E1
Sample Tissue: Human Lung Tumor
Antibody Dilution: 1ug/ml |
|
| Image 6 | Human Fetal Heart
 | Host: Rabbit
Target Name: NR2E1
Sample Type: Human Fetal Heart
Antibody Dilution: 1.0ug/ml |
|
| Image 7 |
 | 25 ug of Hela and MCF7 whole cell extract was loaded onto a 12% SDS-PAGE gel. Blot was incubated with 3 ug/mL of antibody. |
|
