Product Number |
ARP32064_P050 |
Product Page |
www.avivasysbio.com/pax4-antibody-middle-region-arp32064-p050.html |
Name |
PAX4 Antibody - middle region (ARP32064_P050) |
Protein Size (# AA) |
343 amino acids |
Molecular Weight |
38 kDa |
NCBI Gene Id |
5078 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Paired box 4 |
Alias Symbols |
KPD, MODY9 |
Peptide Sequence |
Synthetic peptide located within the following region: RTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLPEDTVRVWFSNRRA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
PAX4 is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The paired box gene 4 is involved in pancreatic islet development and mouse studies have demonstrated a role for this gene in differentiation of insulin-producing .- cells. |
Protein Interactions |
GMCL1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
|
Datasheets/Manuals |
Printable datasheet for anti-PAX4 (ARP32064_P050) antibody |
Specificity |
100% homologous to all 3 isoforms (38, 30, 37kDa). |
Blocking Peptide |
For anti-PAX4 (ARP32064_P050) antibody is Catalog # AAP32064 (Previous Catalog # AAPP02966) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human PAX4 |
Uniprot ID |
O43316 |
Protein Name |
Paired box gene 4 EMBL EAL24318.1 |
Publications |
Zhang, L. et al. KIT is an independent prognostic marker for pancreatic endocrine tumors: a finding derived from analysis of islet cell differentiation markers. Am. J. Surg. Pathol. 33, 1562-9 (2009). 19574886 |
Sample Type Confirmation |
PAX4 is strongly supported by BioGPS gene expression data to be expressed in OVCAR3 PAX4 is supported by BioGPS gene expression data to be expressed in COLO205 |
Protein Accession # |
NP_006184 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_006193 |
Tested Species Reactivity |
Human, Rat |
Gene Symbol |
PAX4 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92% |
Image 1 | Human NCI-H226
| Host: Rabbit Target Name: PAX4 Sample Tissue: Human NCI-H226 Antibody Dilution: 1.0ug/ml |
|