PAX4 Antibody - middle region (ARP32064_P050)

Data Sheet
 
Product Number ARP32064_P050
Product Page www.avivasysbio.com/pax4-antibody-middle-region-arp32064-p050.html
Name PAX4 Antibody - middle region (ARP32064_P050)
Protein Size (# AA) 343 amino acids
Molecular Weight 38 kDa
NCBI Gene Id 5078
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Paired box 4
Alias Symbols KPD, MODY9
Peptide Sequence Synthetic peptide located within the following region: RTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLPEDTVRVWFSNRRA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target PAX4 is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The paired box gene 4 is involved in pancreatic islet development and mouse studies have demonstrated a role for this gene in differentiation of insulin-producing .- cells.
Protein Interactions GMCL1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
WBY
SPR
YCHAROS
Datasheets/Manuals Printable datasheet for anti-PAX4 (ARP32064_P050) antibody
Specificity 100% homologous to all 3 isoforms (38, 30, 37kDa).
Blocking Peptide For anti-PAX4 (ARP32064_P050) antibody is Catalog # AAP32064 (Previous Catalog # AAPP02966)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PAX4
Uniprot ID O43316
Protein Name Paired box gene 4 EMBL EAL24318.1
Publications

Zhang, L. et al. KIT is an independent prognostic marker for pancreatic endocrine tumors: a finding derived from analysis of islet cell differentiation markers. Am. J. Surg. Pathol. 33, 1562-9 (2009). 19574886

Sample Type Confirmation

PAX4 is strongly supported by BioGPS gene expression data to be expressed in OVCAR3

PAX4 is supported by BioGPS gene expression data to be expressed in COLO205

Protein Accession # NP_006184
Purification Affinity Purified
Nucleotide Accession # NM_006193
Tested Species Reactivity Human, Rat
Gene Symbol PAX4
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%
Image 1
Human NCI-H226
Host: Rabbit
Target Name: PAX4
Sample Tissue: Human NCI-H226
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com