| Product Number |
ARP32038_P050 |
| Product Page |
www.avivasysbio.com/neurog1-antibody-c-terminal-region-arp32038-p050.html |
| Name |
NEUROG1 Antibody - C-terminal region (ARP32038_P050) |
| Protein Size (# AA) |
237 amino acids |
| Molecular Weight |
26kDa |
| NCBI Gene Id |
4762 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Neurogenin 1 |
| Alias Symbols |
AKA, ngn1, Math4C, bHLHa6, NEUROD3 |
| Peptide Sequence |
Synthetic peptide located within the following region: ASDAESWGSGAAAASPLSDPSSPAASEDFTYRPGDPVFSFPSLPKDLLHT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Fanous,A.H., (2007) Am. J. Med. Genet. B Neuropsychiatr. Genet. 144 (2), 207-214 |
| Description of Target |
NEUROG1 contains 1 basic helix-loop-helix (bHLH) domain. It appears to mediate neuronal differentiation. |
| Protein Interactions |
TCF4; CBFA2T2; TARBP2; RUNX1T1; SMAD1; CREBBP; EP300; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-NEUROG1 (ARP32038_P050) antibody |
| Blocking Peptide |
For anti-NEUROG1 (ARP32038_P050) antibody is Catalog # AAP32038 (Previous Catalog # AAPP02940) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human NEUROG1 |
| Uniprot ID |
Q92886 |
| Protein Name |
Neurogenin-1 |
| Protein Accession # |
NP_006152 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_006161 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
NEUROG1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 79%; Rat: 93% |
| Image 1 | Human Placenta
 | WB Suggested Anti-NEUROG1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Placenta |
| | Image 2 | Mouse Cochlea
 | Sample Type: Mouse Cochlea
Dilution: 1:500 |
|
|
