IRF6 Antibody - middle region (ARP31995_P050)

• Product Number: ARP31995_P050
• Name: IRF6 Antibody - middle region (ARP31995_P050)
• Protein Size (# AA): 467 amino acids
• Molecular Weight: 53kDa
• NCBI Gene Id: 3664
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Interferon regulatory factor 6
• Alias Symbols: LPS, PIT, PPS, VWS, OFC6, PPS1, VWS1
• Peptide Sequence: Synthetic peptide located within the following region: IPVVARMIYEMFSGDFTRSFDSGSVRLQISTPDIKDNIVAQLKQLYRILQ
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Vieira,A.R., (er) Arch. Oral Biol. (2008) In press
• Description of Target: IRF6 is a member of the interferon regulatory transcription factor (IRF) family. Family members share a highly-conserved N-terminal helix-turn-helix DNA-binding domain and a less conserved C-terminal protein-binding domain. Mutations in its gene can cause van der Woude syndrome and popliteal pterygium syndrome. This protein is involved in palate formation.The protein encoded by this gene shares strong similarity with Saccharomyces cerevisiae Cdc23, a protein essential for cell cycle progression through the G2/M transition. This protein is a component of anaphase-promoting complex (APC), which is composed of eight protein subunits and highly conserved in eucaryotic cells. APC catalyzes the formation of cyclin B-ubiquitin conjugate that is responsible for the ubiquitin-mediated proteolysis of B-type cyclins. This protein and 3 other members of the APC complex contain the TPR (tetratricopeptide repeat), a protein domain important for protein-protein interaction. This gene encodes a member of the interferon regulatory transcription factor (IRF) family. Family members share a highly-conserved N-terminal helix-turn-helix DNA-binding domain and a less conserved C-terminal protein-binding domain. Mutations in this gene can cause van der Woude syndrome and popliteal pterygium syndrome. This protein is involved in palate formation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: HHV8GK18_gp81; UBC; BNC2; IRF5; IRF8; ZBTB3; RFX3; TLX2; LBP;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-IRF6 (ARP31995_P050) antibody is Catalog # AAP31995 (Previous Catalog # AAPP02892)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IRF6
• Uniprot ID: O14896
• Protein Name: Interferon regulatory factor 6
• Publications:

  Iwata, J. et al. Smad4-Irf6 genetic interaction and TGFbeta-mediated IRF6 signaling cascade are crucial for palatal fusion in mice. Development 140, 1220-30 (2013). 23406900

• Protein Accession #: NP_006138
• Purification: Affinity Purified
• Nucleotide Accession #: NM_006147
• Tested Species Reactivity: Human
• Gene Symbol: IRF6
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 85%
• Image 1: r-IRF6
  
  WB Suggested Anti-IRF6 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:12500
  Positive Control: Transfected 293T
• Image 2: Human Placenta
  
  Immunohistochemistry with Placenta tissue at an antibody concentration of 5ug/ml using anti-IRF6 antibody (ARP31995_P050)