LASS2 Antibody - N-terminal region (ARP31922_P050)

Data Sheet
 
Product Number ARP31922_P050
Product Page www.avivasysbio.com/lass2-antibody-n-terminal-region-arp31922-p050.html
Name LASS2 Antibody - N-terminal region (ARP31922_P050)
Protein Size (# AA) 192 amino acids
Molecular Weight 45kDa
NCBI Gene Id 29956
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Ceramide synthase 2
Alias Symbols L3, LASS2, SP260, TMSG1
Peptide Sequence Synthetic peptide located within the following region: IVRYFFELYVATPLAALLNIKEKTRLRAPPNATLEHFYLTSGKQPKQVEV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target LASS2 is a protein that has sequence similarity to yeast longevity assurance gene 1. Mutation or overexpression of the related gene in yeast has been shown to alter yeast lifespan. The human protein may play a role in the regulation of cell growth.This gene encodes a protein that has sequence similarity to yeast longevity assurance gene 1. Mutation or overexpression of the related gene in yeast has been shown to alter yeast lifespan. The human protein may play a role in the regulation of cell growth. Alternatively spliced transcript variants encoding the same protein have been described.
Protein Interactions HSP90AA1; ELOVL3; ELOVL7; ELOVL6; ELOVL1; ELOVL5; ELOVL2; HSD17B12; TECR; ELOVL4; vpu; SLC39A1; SLC19A2; UBC; TMBIM6; SLC22A1; PEX6; ATP6V0C; ASGR2; ASGR1; FLOT1; FUBP1; NDN;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CERS2 (ARP31922_P050) antibody
Blocking Peptide For anti-CERS2 (ARP31922_P050) antibody is Catalog # AAP31922 (Previous Catalog # AAPP02819)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human LASS2
Uniprot ID Q96G23
Protein Name Ceramide synthase 2
Sample Type Confirmation

CERS2 is supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # CAI13332
Purification Affinity Purified
Nucleotide Accession # NM_022075
Tested Species Reactivity Human
Gene Symbol CERS2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Image 1
Human HepG2
WB Suggested Anti-LASS2 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysateCERS2 is supported by BioGPS gene expression data to be expressed in HepG2
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com