HEYL Antibody - N-terminal region (ARP31866_T100)

Data Sheet
 
Product Number ARP31866_T100
Product Page www.avivasysbio.com/heyl-antibody-n-terminal-region-arp31866-t100.html
Product Name HEYL Antibody - N-terminal region (ARP31866_T100)
Size 100 ul
Gene Symbol HEYL
Alias Symbols HEY3, HRT3, bHLHb33
Protein Size (# AA) 328 amino acids
Molecular Weight 35kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 26508
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Hairy/enhancer-of-split related with YRPW motif-like
Peptide Sequence Synthetic peptide located within the following region: MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKRRGI
Target Reference Nakagawa,O., et al., (2000) McFadden,D.G., Nakagawa,M., Proc. Natl. Acad. Sci. U.S.A. 97 (25), 13655-13660
Description of Target HEYL belongs to hairy-related bHLH transcription factor family. HEY genes are candidates for several human or mouse disease loci.
Protein Interactions RPGRIP1; RBPMS; MDFI; ZNF512B; HIPK3; LAPTM5; SKIL; ATXN1; PPP1CA; SMAD9; SMAD7; SMAD3; HTT; APP; UBC; SP8; ATF7IP; HAND2; HAND1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Tips Information

See our General FAQ page.

Datasheets/Manuals Printable datasheet for anti-HEYL (ARP31866_T100) antibody
Protocol
The following related protocols are available on www.avivasysbio.com
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-HEYL (ARP31866_T100) antibody is Catalog # AAP31866 (Previous Catalog # AAPP02661)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human HEYL
Complete computational species homology data Anti-HEYL (ARP31866_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HEYL.
Swissprot Id Q9NQ87
Protein Name Hairy/enhancer-of-split related with YRPW motif-like protein
Publications

Morrow, D. et al. Sonic Hedgehog induces Notch target gene expression in vascular smooth muscle cells via VEGF-A. Arterioscler. Thromb. Vasc. Biol. 29, 1112-8 (2009). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat 19407245

Protein Accession # NP_055386
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HEYL.
Nucleotide Accession # NM_014571
Replacement Item This antibody may replace item sc-16448 from Santa Cruz Biotechnology.
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 92%; Guinea Pig: 100%; Horse: 85%; Human: 100%; Mouse: 100%; Rat: 100%
Image 1
Human Muscle
WB Suggested Anti-HEYL Antibody Titration: 1.0ug/ml
ELISA Titer: 1:312500
Positive Control: Human Muscle
Image 2
293T, HepG2
Host: Rabbit
Target: HEYL
Positive control (+): 293T (2T)
Negative control (-): HepG2 (HG)
Antibody concentration: 3ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com