EHF Antibody - N-terminal region (ARP31861_T100)

• Product Number: ARP31861_T100
• Name: EHF Antibody - N-terminal region (ARP31861_T100)
• Protein Size (# AA): 300 amino acids
• Molecular Weight: 35 kDa
• NCBI Gene Id: 26298
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Ets homologous factor
• Alias Symbols: ESE3, ESEJ, ESE3B
• Peptide Sequence: Synthetic peptide located within the following region: RAAGTAGQLLYSNLQHLKWNGQCSSDLFQSTHNVIVKTEQTEPSIMNTWK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Silverman,E.S., et al., (2002) Am. J. Respir. Cell Mol. Biol. 27 (6), 697-704
• Description of Target: EHF belongs to an ETS transcription factor subfamily characterized by epithelial-specific expression (ESEs). The encoded protein acts as a transcriptional repressor and may be associated with asthma susceptibility. This protein may be involved in epithelial differentiation and carcinogenesis.
• Protein Interactions: XRCC5; XRCC6; FRZB; ELF3;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-EHF (ARP31861_T100) antibody is Catalog # AAP31861 (Previous Catalog # AAPP02656)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EHF
• Uniprot ID: Q9NZC4
• Protein Name: ETS homologous factor
• Protein Accession #: NP_036285
• Purification: Protein A purified
• Nucleotide Accession #: NM_012153
• Tested Species Reactivity: Human
• Gene Symbol: EHF
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-EHF Antibody Titration: 1.25ug/ml
  ELISA Titer: 1:62500
  Positive Control: Jurkat cell lysate
• Image 2: Human kidney
  
  Human kidney