Product Number |
ARP31837_T100-Biotin |
Product Page |
www.avivasysbio.com/ebf3-antibody-middle-region-biotin-arp31837-t100-biotin.html |
Name |
EBF3 Antibody - middle region : Biotin (ARP31837_T100-Biotin) |
Protein Size (# AA) |
551 amino acids |
Molecular Weight |
60kDa |
Conjugation |
Biotin |
NCBI Gene Id |
253738 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Early B-cell factor 3 |
Alias Symbols |
COE3, OE-2, EBF-3, HADDS, O/E-2 |
Peptide Sequence |
Synthetic peptide located within the following region: AHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQ |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Reference |
Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45 |
Description of Target |
EB1 family proteins are evolutionarily conserved proteins that bind microtubule plus-ends and centrosomes and regulate the dynamics and organization of microtubules. Human EB1 family proteins, which include EB1, EBF3, and RP1, also associate with the tumor suppressor protein adenomatous polyposis coli (APC) and p150glued, a component of the dynactin complex. |
Protein Interactions |
ZNF423; |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-EBF3 (ARP31837_T100-Biotin) antibody |
Blocking Peptide |
For anti-EBF3 (ARP31837_T100-Biotin) antibody is Catalog # AAP31837 (Previous Catalog # AAPP02632) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human EBF3 |
Uniprot ID |
Q9H4W6 |
Protein Name |
Transcription factor COE3 |
Publications |
Bennett, K. L., Romigh, T. & Eng, C. Disruption of transforming growth factor-beta signaling by five frequently methylated genes leads to head and neck squamous cell carcinoma pathogenesis. Cancer Res. 69, 9301-5 (2009). ChIP, Zebrafish, Rat, Bovine, Dog, Pig, Rabbit, Guinea pig, Human, Mouse 19934318 |
Protein Accession # |
NP_001005463 |
Nucleotide Accession # |
NM_001005463 |
Gene Symbol |
EBF3 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Image 1 | |
|