| Product Number |
ARP31830_T100-HRP |
| Product Page |
www.avivasysbio.com/zfp95-antibody-n-terminal-region-hrp-arp31830-t100-hrp.html |
| Name |
ZFP95 Antibody - N-terminal region : HRP (ARP31830_T100-HRP) |
| Protein Size (# AA) |
839 amino acids |
| Molecular Weight |
97kDa |
| Conjugation |
HRP: Horseradish Peroxidase |
| NCBI Gene Id |
23660 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger with KRAB and SCAN domains 5 |
| Alias Symbols |
ZFP95, ZFP-95, ZNF914, ZSCAN37 |
| Peptide Sequence |
Synthetic peptide located within the following region: MIMTESREVIDLDPPAETSQEQEDLFIVKVEEEDCTWMQEYNPPTFETFY |
| Product Format |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Reference |
Scherer,S.W., et al., (2003) Science 300 (5620), 767-772 |
| Description of Target |
ZFP95 is a zinc finger protein of the Kruppel family. It contains a SCAN box and a KRAB A domain. A similar protein in mouse is differentially expressed in spermatogenesis. |
| Protein Interactions |
SUV39H1; THOC3; THOC5; TNNT1; ZSCAN1; ZBTB9; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-ZKSCAN5 (ARP31830_T100-HRP) antibody |
| Blocking Peptide |
For anti-ZKSCAN5 (ARP31830_T100-HRP) antibody is Catalog # AAP31830 (Previous Catalog # AAPP02625) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP95 |
| Uniprot ID |
Q9Y2L8 |
| Protein Name |
Zinc finger protein with KRAB and SCAN domains 5 |
| Protein Accession # |
NP_055384 |
| Nucleotide Accession # |
NM_014569 |
| Gene Symbol |
ZKSCAN5 |
| Predicted Species Reactivity |
Human, Mouse, Dog, Guinea Pig, Horse, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 92%; Guinea Pig: 86%; Horse: 92%; Human: 100%; Mouse: 79%; Pig: 100% |
| Image 1 | |
