TLR5 Antibody - N-terminal region (ARP31753_P050)

• Product Number: ARP31753_P050
• Name: TLR5 Antibody - N-terminal region (ARP31753_P050)
• Protein Size (# AA): 858 amino acids
• Molecular Weight: 98kDa
• NCBI Gene Id: 7100
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Toll-like receptor 5
• Alias Symbols: SLE1, TIL3, SLEB1, MELIOS
• Peptide Sequence: Synthetic peptide located within the following region: QLQLLELGSQYTPLTIDKEAFRNLPNLRILDLGSSKIYFLHPDAFQGLFH
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Hume,G.E., (2008) Inflamm. Bowel Dis. 14 (5), 585-590
• Description of Target: TLR5 participates in the innate immune response to microbial agents. It mediates detection of bacterial flagellins. TLR5 acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene product is expressed in myelomonocytic cells, and recognizes bacterial flagellin, a principal component of bacterial flagella and a virulence factor. The activation of this receptor mobilizes the nuclear factor NF-kappaB and stimulates tumour necrosis factor-alpha production. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: RNF216; SIGIRR; TLR4; MYD88; TLR1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-TLR5 (ARP31753_P050) antibody is Catalog # AAP31753 (Previous Catalog # AAPP23838)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TLR5
• Uniprot ID: O60602
• Protein Name: Toll-like receptor 5
• Protein Accession #: NP_003259
• Purification: Affinity Purified
• Nucleotide Accession #: NM_003268
• Tested Species Reactivity: Human
• Gene Symbol: TLR5
• Predicted Species Reactivity: Human, Rat, Cow, Goat, Pig, Sheep
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Goat: 79%; Human: 100%; Pig: 83%; Rat: 79%; Sheep: 79%
• Image 1: Human HepG2
  
  WB Suggested Anti-TLR5 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: HepG2 cell lysate