| Product Number |
ARP31541_P050 |
| Product Page |
www.avivasysbio.com/4930567h17rik-antibody-middle-region-arp31541-p050.html |
| Name |
4930567H17Rik Antibody - middle region (ARP31541_P050) |
| Protein Size (# AA) |
233 amino acids |
| Molecular Weight |
27kDa |
| NCBI Gene Id |
619303 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
RIKEN cDNA 4930567H17 gene |
| Alias Symbols |
- |
| Peptide Sequence |
Synthetic peptide located within the following region: TLSSYDPCRYILKAALSVITAWENTLEEEEEDEEEDEEEEEMEEEDEGEE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-4930567H17Rik (ARP31541_P050) antibody |
| Blocking Peptide |
For anti-4930567H17Rik (ARP31541_P050) antibody is Catalog # AAP31541 |
| Uniprot ID |
Q3V0K5 |
| Protein Name |
Protein 4930567H17Rik Ensembl ENSMUSP00000090060 |
| Protein Accession # |
NP_001028979 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001033807 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
4930567H17Rik |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Yeast, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 86%; Horse: 92%; Human: 100%; Mouse: 100%; Pig: 92%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 100% |
| Image 1 | Mouse Kidney
 | WB Suggested Anti-4930567H17Rik Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Kidney |
|
|
