KLF8 Antibody - N-terminal region : HRP (ARP31533_P050-HRP)

• Product Number: ARP31533_P050-HRP
• Name: KLF8 Antibody - N-terminal region : HRP (ARP31533_P050-HRP)
• Protein Size (# AA): 359 amino acids
• Molecular Weight: 39kDa
• Conjugation: HRP: Horseradish Peroxidase
• NCBI Gene Id: 11279
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Kruppel-like factor 8
• Alias Symbols: BKLF3, ZNF741
• Peptide Sequence: Synthetic peptide located within the following region: LSFHKPKAPLQPASMLQAPIRPPKPQSSPQTLVVSTSTSDMSTSANIPTV
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Reference: Lossi,A.M., et al., (2002) J. Med. Genet. 39 (2), 113-117
• Description of Target: KLF8 is abnormally expressed in female patients with X autosome translocation t(X;21)(p11.2;q22.3) and non-syndromic mental retardation.
• Protein Interactions: Dlg4; APP; UBC; XPO1; PARP1; KAT2B; EP300; CREBBP; FHL3; CTBP2;
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Blocking Peptide: For anti-KLF8 (ARP31533_P050-HRP) antibody is Catalog # AAP31533 (Previous Catalog # AAPP02295)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KLF8
• Uniprot ID: O95600
• Protein Name: Krueppel-like factor 8
• Publications:

  Fu, W.-J. et al. Small interference RNA targeting Krueppel-like factor 8 inhibits the renal carcinoma 786-0 cells growth in vitro and in vivo. J. Cancer Res. Clin. Oncol. 136, 1255-65 (2010). WB, ICC/IF, IP, Human, Rabbit, Dog, Bovine, Horse 20182889

  Li, J.-C. et al. Up-regulation of Krueppel-like factor 8 promotes tumor invasion and indicates poor prognosis for hepatocellular carcinoma. Gastroenterology 139, 2146-2157.e12 (2010). WB, IHC, Human, Rabbit, Dog, Bovine, Horse 20728449

  Han, S. et al. Krueppel?like factor expression and correlation with FAK, MMP-9 and E-cadherin expression in hepatocellular carcinoma. Mol. Med. Rep. 8, 81-8 (2013). IHC, Human, Rabbit, Dog, Bovine, Horse 23670717

• Protein Accession #: NP_009181
• Purification: Affinity Purified
• Nucleotide Accession #: NM_007250
• Gene Symbol: KLF8
• Predicted Species Reactivity: Human, Cow, Dog, Horse, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Dog: 79%; Horse: 77%; Human: 100%; Rabbit: 86%
• Image 1: