EAP30 Antibody - N-terminal region (ARP31531_P050)

• Product Number: ARP31531_P050
• Name: EAP30 Antibody - N-terminal region (ARP31531_P050)
• Protein Size (# AA): 258 amino acids
• Molecular Weight: 29kDa
• NCBI Gene Id: 11267
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: SNF8, ESCRT-II complex subunit, homolog (S. cerevisiae)
• Alias Symbols: Dot3, EAP30, VPS22
• Peptide Sequence: Synthetic peptide located within the following region: MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEF
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Schmidt,A.E., et al., (1999) Biol. Chem. 274 (31), 21981-21985
• Description of Target: ELL encodes an RNA polymerase II transcription factor that undergoes frequent translocation in acute myeloid leukemia (AML). In addition to its elongation activity, ELL contains a novel type of RNA polymerase II interaction domain that is capable of repressing polymerase activity in promoter-specific transcription. EAP30 is a subunit of the ELL complex. EAP30 can interact with ELL and derepress ELL's inhibitory activity in vitro.SNF8, VPS25 (MIM 610907), and VPS36 (MIM 610903) form ESCRT-II (endosomal sorting complex required for transport II), a complex involved in endocytosis of ubiquitinated membrane proteins. SNF8, VPS25, and VPS36 are also associated in a multiprotein complex with RNA polymerase II elongation factor (ELL; MIM 600284) (Slagsvold et al., 2005 [PubMed 15755741]; Kamura et al., 2001 [PubMed 11278625]).[supplied by OMIM].
• Protein Interactions: GOLGA2; VPS25; TRIM54; VAC14; UBC; BCAT1; SUV39H2; ACBD3; DUS3L; WDR12; PRMT6; RPUSD2; KDM1A; EFTUD2; TTC1; HARS; GTF2F1; GTF2E1; ELL; RBP1; MCM2; ADORA1; METTL14; NUDCD3; RILP; VPS36; CHMP6; VPS28; SNF8; TSG101; VPS20; NIF3L1; DVL2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Additional Information: IHC Information: Human Heart: Formalin-Fixed, Paraffin-Embedded (FFPE)
  IHC Information: Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)
• Blocking Peptide: For anti-SNF8 (ARP31531_P050) antibody is Catalog # AAP31531 (Previous Catalog # AAPS26305)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EAP30
• Uniprot ID: Q96H20
• Protein Name: Vacuolar-sorting protein SNF8
• Sample Type Confirmation:

  SNF8 is supported by BioGPS gene expression data to be expressed in HepG2

• Protein Accession #: NP_009172
• Purification: Affinity Purified
• Nucleotide Accession #: NM_007241
• Tested Species Reactivity: Human
• Gene Symbol: SNF8
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Image 1: Human heart
  
  Anti-SNF8 / EAP30 antibody IHC of human heart. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. EAP30 Antibody ARP31531_P050 concentration 5 ug/ml.
• Image 2: Human spleen
  
  Anti-SNF8 / EAP30 antibody IHC of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. EAP30 Antibody ARP31531_P050 concentration 5 ug/ml.
• Image 3: Human Stomach
  
  Rabbit Anti-EAP30 Antibody
  Catalog Number: ARP31531
  Paraffin Embedded Tissue: Human Stomach
  Cellular Data: Epithelial cells of Fundic Gland and Surface Mucous Cells
  Antibody Concentration: 4.0-8.0 ug/ml
  Magnification: 400X
• Image 4: Human HepG2
  
  WB Suggested Anti-EAP30 Antibody Titration: 5.0ug/ml
  Positive Control: HepG2 cell lysateSNF8 is supported by BioGPS gene expression data to be expressed in HepG2