PPARGC1A Antibody - N-terminal region (ARP31507_P050)

Data Sheet
Product Number ARP31507_P050
Product Page www.avivasysbio.com/ppargc1a-antibody-n-terminal-region-arp31507-p050.html
Name PPARGC1A Antibody - N-terminal region (ARP31507_P050)
Gene Symbol PPARGC1A
Alias Symbols LEM6, PGC-1(alpha), PGC-1v, PGC1, PGC1A, PPARGC1
Protein Size (# AA) 798 amino acids
Molecular Weight 91kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 10891
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Peroxisome proliferator-activated receptor gamma, coactivator 1 alpha
Peptide Sequence Synthetic peptide located within the following region: PSFDALTDGDVTTDNEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQL
Target Reference Vimaleswaran,K.S., (er) J. Appl. Physiol. (2008) In press
Description of Target PPARGC1A is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity.The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PPARGC1A (ARP31507_P050) antibody
Blocking Peptide For anti-PPARGC1A (ARP31507_P050) antibody is Catalog # AAP31507 (Previous Catalog # AAPP02269)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PPARGC1A
Complete computational species homology data Anti-PPARGC1A (ARP31507_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express PPARGC1A.
Swissprot Id Q9UBK2
Protein Name Peroxisome proliferator-activated receptor gamma coactivator 1-alpha

Lee, Y. H. et al. Integrative toxicoproteomics implicates impaired mitochondrial glutathione import as an off-target effect of troglitazone. J. Proteome Res. 12, 2933-45 (2013). IF, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 23659346

Protein Accession # NP_037393
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express PPARGC1A.
Nucleotide Accession # NM_013261
Replacement Item This antibody may replace item sc-13067 from Santa Cruz Biotechnology.
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Application IF, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Zebrafish: 82%
Image 1
Human 786-0
Host: Rabbit
Target Name: PPARGC1A
Sample Tissue: Human 786-0
Antibody Dilution: 1.0ug/ml
Image 2
Mouse retina
Sample Type:
Mouse retina
Primary Antibody Dilution:
Secondary Antibody:
Donkey anti rabbit-Cy3
Secondary Antibody Dilution:
Color/Signal Descriptions:
Gene Name:
Submitted by:
Dr. Joshua Sanes

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com