CDX2 Antibody - middle region (ARP31476_P050)

• Product Number: ARP31476_P050
• Name: CDX2 Antibody - middle region (ARP31476_P050)
• Protein Size (# AA): 313 amino acids
• Molecular Weight: 34 kDa
• NCBI Gene Id: 1045
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Caudal type homeobox 2
• Alias Symbols: CDX3, CDX-3, CDX2/AS
• Peptide Sequence: Synthetic peptide located within the following region: QRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRY
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Saad,R.S., et al., (2004) J. Clin. Pathol. 122 (3), 421-427
• Description of Target: CDX2 encodes a protein that plays an important role in gallbladder carcinogenesis with intestinal differentiation. Cdx2 is a highly sensitive marker for Barrett's esophagus.
• Protein Interactions: CDK2; SMARCD1; SMARCB1; SMARCA4; SMARCA2; KDM5B; UBB; PAX6; GSK3B; EP300; CDX2; MAPK14; CREBBP; MAPK1; HNF1A; ACAT2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Blocking Peptide: For anti-CDX2 (ARP31476_P050) antibody is Catalog # AAP31476 (Previous Catalog # AAPP02238)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CDX2
• Uniprot ID: Q99626
• Protein Name: Homeobox protein CDX-2
• Publications:

  Tajbakhsh, J. Covisualization of methylcytosine, global DNA, and protein biomarkers for In Situ 3D DNA methylation phenotyping of stem cells. Methods Mol. Biol. 1052, 77-88 (2013). 23593143

• Protein Accession #: NP_001256
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001265
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: CDX2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 91%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human Brain
  
  WB Suggested Anti-CDX2 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: Human brain
• Image 2: Mouse Skeletal Muscle
  
  Host: Mouse
  Target Name: CDX2
  Sample Tissue: Mouse Skeletal Muscle
  Antibody Dilution: 1ug/ml
• Image 3:
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment. The protein may be modified by phosphorylation.