OLIG2 Antibody - N-terminal region (ARP31464_P050)

Data Sheet
 
Product Number ARP31464_P050
Product Page www.avivasysbio.com/olig2-antibody-n-terminal-region-arp31464-p050.html
Name OLIG2 Antibody - N-terminal region (ARP31464_P050)
Protein Size (# AA) 323 amino acids
Molecular Weight 32kDa
NCBI Gene Id 10215
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Oligodendrocyte lineage transcription factor 2
Alias Symbols BHLHB1, OLIGO2, RACK17, PRKCBP2, bHLHe19
Peptide Sequence Synthetic peptide located within the following region: MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Mitkus,S.N., Schizophr. Res. 98 (1-3), 129-138 (2008)
Description of Target OLIG2 is a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. OLIG2 is an essential regulator of ventral neuroectodermal progenitor cell fate. It is associated with T-cell acute lymphoblastic leukemia due to a chromosomal translocation t(14;21)(q11.2;q22). OLIG2 might play a role in learning deficits associated with Down syndrome.This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal translocation t(14;21)(q11.2;q22) associated with T-cell acute lymphoblastic leukemia. Its chromosomal location is within a region of chromosome 21 which has been suggested to play a role in learning deficits associated with Down syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions CUL3; SRRM1; SOX8; NKX2-2; EP300; SOX10;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-OLIG2 (ARP31464_P050) antibody
Blocking Peptide For anti-OLIG2 (ARP31464_P050) antibody is Catalog # AAP31464 (Previous Catalog # AAPS08403)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human OLIG2
Uniprot ID Q13516
Protein Name Oligodendrocyte transcription factor 2
Protein Accession # NP_005797
Purification Affinity Purified
Nucleotide Accession # NM_005806
Tested Species Reactivity Human
Gene Symbol OLIG2
Predicted Species Reactivity Human, Mouse, Rat, Dog, Guinea Pig, Horse, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 85%
Image 1
Human 293T
WB Suggested Anti-OLIG2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T
Image 2
human LCL and mouse brains
Sample Type: Human Optic Nerve and Spinal CordCellular Target: Oligoden Drocyte Lineage Cells
Dilution: 1:500
Image 3
human LCL and mouse brains
OLIG2 antibody - N-terminal region (ARP31464_P050) validated by WB using human LCL and mouse brains at 1:1000.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com