POU6F1 Antibody - middle region (ARP31433_P050)

Data Sheet
 
Product Number ARP31433_P050
Product Page www.avivasysbio.com/pou6f1-antibody-middle-region-arp31433-p050.html
Name POU6F1 Antibody - middle region (ARP31433_P050)
Protein Size (# AA) 301 amino acids
Molecular Weight 33kDa
NCBI Gene Id 5463
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name POU class 6 homeobox 1
Alias Symbols BRN5, MPOU, TCFB1
Peptide Sequence Synthetic peptide located within the following region: YFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSKLNVFQIP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Wey,E., et al., (1994) J. Biochem. 220 (3), 753-762
Description of Target The POU6F1 gene encodes a protein that is part of a family of transcription factors which exhibit distinct temporal and spatial patterns of expression.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-POU6F1 (ARP31433_P050) antibody
Blocking Peptide For anti-POU6F1 (ARP31433_P050) antibody is Catalog # AAP31433 (Previous Catalog # AAPP02191)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human POU6F1
Uniprot ID Q14863
Protein Name POU domain, class 6, transcription factor 1
Protein Accession # NP_002693
Purification Affinity Purified
Nucleotide Accession # NM_002702
Tested Species Reactivity Human
Gene Symbol POU6F1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Image 1
Human 293T
Host: Rabbit
Target Name: POU6F1
Sample Tissue: Human 293T
Antibody Dilution: 1.0ug/ml
Image 2
Human Intestine
Human Intestine
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com