Product Number |
ARP31433_P050 |
Product Page |
www.avivasysbio.com/pou6f1-antibody-middle-region-arp31433-p050.html |
Name |
POU6F1 Antibody - middle region (ARP31433_P050) |
Protein Size (# AA) |
301 amino acids |
Molecular Weight |
33kDa |
NCBI Gene Id |
5463 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
POU class 6 homeobox 1 |
Alias Symbols |
BRN5, MPOU, TCFB1 |
Peptide Sequence |
Synthetic peptide located within the following region: YFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSKLNVFQIP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Wey,E., et al., (1994) J. Biochem. 220 (3), 753-762 |
Description of Target |
The POU6F1 gene encodes a protein that is part of a family of transcription factors which exhibit distinct temporal and spatial patterns of expression. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-POU6F1 (ARP31433_P050) antibody |
Blocking Peptide |
For anti-POU6F1 (ARP31433_P050) antibody is Catalog # AAP31433 (Previous Catalog # AAPP02191) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human POU6F1 |
Uniprot ID |
Q14863 |
Protein Name |
POU domain, class 6, transcription factor 1 |
Protein Accession # |
NP_002693 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_002702 |
Tested Species Reactivity |
Human |
Gene Symbol |
POU6F1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Rabbit, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92% |
Image 1 | Human 293T
| Host: Rabbit Target Name: POU6F1 Sample Tissue: Human 293T Antibody Dilution: 1.0ug/ml |
| Image 2 | Human Intestine
| Human Intestine |
|
|