TAL1 Antibody - N-terminal region (ARP31428_P050)

Data Sheet
 
Product Number ARP31428_P050
Product Page www.avivasysbio.com/tal1-antibody-n-terminal-region-arp31428-p050.html
Name TAL1 Antibody - N-terminal region (ARP31428_P050)
Protein Size (# AA) 331 amino acids
Molecular Weight 34kDa
NCBI Gene Id 6886
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name T-cell acute lymphocytic leukemia 1
Alias Symbols SCL, TCL5, tal-1, bHLHa17
Peptide Sequence Synthetic peptide located within the following region: TERPPSEAARSDPQLEGRDAAEASMAPPHLVLLNGVAKETSRAAAAEPPV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Zhang,M. (2008) J. Biol. Chem. 283 (11), 6717-6727
Description of Target TAL1 is implicated in the genesis of hemopoietic malignancies. It may play an important role in hemopoietic differentiation. It also serves as a positive regulator of erythroid differentiation
Protein Interactions ELSPBP1; SIN3A; KAT2B; EP300; HOXB9; DRG1; CHD3; ZHX1; STUB1; UBC; RB1; SSBP2; SSBP3; RCOR1; KDM1A; LDB1; TCF12; TCF3; RBBP7; LYL1; HDAC2; HDAC1; CHD4; CBFA2T3; RUNX1; SUPT16H; TAL1; CDK9; TRIM33; SUV39H1; SATB1; TRIM27; NCAPG2; MAPK3; SP1; LMO1; LMO2; GA
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TAL1 (ARP31428_P050) antibody
Blocking Peptide For anti-TAL1 (ARP31428_P050) antibody is Catalog # AAP31428 (Previous Catalog # AAPP03106)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TAL1
Uniprot ID P17542
Protein Name T-cell acute lymphocytic leukemia protein 1
Publications

Hosur, V. et al. Retrotransposon insertion in the T-cell acute lymphocytic leukemia 1 (Tal1) gene is associated with severe renal disease and patchy alopecia in Hairpatches (Hpt) mice. PLoS One 8, e53426 (2013). 23301070

Protein Accession # NP_003180
Purification Affinity Purified
Nucleotide Accession # NM_003189
Tested Species Reactivity Human
Gene Symbol TAL1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 85%; Dog: 85%; Human: 100%; Mouse: 92%; Pig: 92%; Rabbit: 92%; Rat: 85%
Image 1
Human Fetal Liver
Host: Rabbit
Target Name: TAL1
Sample Type: Human Fetal Liver
Antibody Dilution: 1.0ug/ml
Image 2
Human Brain
WB Suggested Anti-TAL1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human brain
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com