POU1F1 Antibody - C-terminal region (ARP31419_P050)

• Product Number: ARP31419_P050
• Name: POU1F1 Antibody - C-terminal region (ARP31419_P050)
• Protein Size (# AA): 291 amino acids
• Molecular Weight: 33kDa
• NCBI Gene Id: 5449
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: POU class 1 homeobox 1
• Alias Symbols: PIT1, CPHD1, GHF-1, Pit-1, POU1F1a
• Peptide Sequence: Synthetic peptide located within the following region: QEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSLFSISKEHLECR
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Dattani,M.T., et al., (2003) GrowthHorm.IGFRes.16(9),1207-1209
• Description of Target: PIT1 is a pituitary-specific transcription factor responsible for pituitary development and hormone expression in mammals and is a member of the POU family of transcription factors that regulate mammalian development. The POU family is so named because the first 3 members identified were PIT1 and OCT1 of mammals, and Unc-86 of C. elegans. PIT1 contains 2 protein domains, termed POU-specific and POU-homeo, which are both necessary for high affinity DNA binding on genes encoding growth hormone and prolactin. PIT1 is also important for regulation of the genes encoding prolactin and thyroid-stimulating hormone beta subunit by thyrotropin-releasing hormone and cyclic AMP.
• Protein Interactions: CEBPD; NCOR1; CREBBP; MED1; GATA2; NR1I3; NR1I2; PITX1; JUN; ETS1; NR3C1; VDR; PPARG; PPARA;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-POU1F1 (ARP31419_P050) antibody is Catalog # AAP31419 (Previous Catalog # AAPP03105)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human POU1F1
• Uniprot ID: P28069
• Protein Name: Pituitary-specific positive transcription factor 1
• Publications:

  Tennant, D. A. & Gottlieb, E. HIF prolyl hydroxylase-3 mediates alpha-ketoglutarate-induced apoptosis and tumor suppression. J. Mol. Med. (Berl). 88, 839-49 (2010). 20383689

• Protein Accession #: NP_000297
• Purification: Affinity Purified
• Nucleotide Accession #: NM_000306
• Tested Species Reactivity: Human
• Gene Symbol: POU1F1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
• Image 1: Human pituitary
  
  Rabbit Anti-POU1F1 Antibody
  Catalog Number: ARP31419
  Paraffin Embedded Tissue: Human pituitary
  Observed staining: Nuclear
  Primary Antibody Dilution: 1:600
  Conditions: Primary antibody incubation at RT for 1 hour. Detection was done using HRP -polymer conjugated anti-rabbit secondary antibody by incubating for 30 minutes at RT.
  Chromogen: DAB
  Counterstaining: Hematoxylin.
• Image 2: Human HT1080 Whole Cell
  
  Host: Rabbit
  Target Name: POU1F1
  Sample Tissue: Human HT1080 Whole Cell
  Antibody Dilution: 1ug/ml
• Image 3: Human HepG2
  
  WB Suggested Anti-POU1F1 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:12500
  Positive Control: HepG2 cell lysate