| Product Number |
ARP31272_P050 |
| Product Page |
www.avivasysbio.com/dr1-antibody-middle-region-arp31272-p050.html |
| Name |
Dr1 Antibody - middle region (ARP31272_P050) |
| Protein Size (# AA) |
176 amino acids |
| Molecular Weight |
19kDa |
| NCBI Gene Id |
13486 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Down-regulator of transcription 1 |
| Alias Symbols |
Dr, NC, NC2, Dr1l, NC2be, NC2beta, 1700121L09Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: KKTISPEHVIQALESLGFGSYISEVKEVLQECKTVALKRRKASSRLENLG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The association of the DR1/DRAP1 heterodimer with TBP results in a functional repression of both activated and basal transcription of class II genes. This interaction precludes the formation of a transcription-competent complex by inhibiting the association of TFIIA and/or TFIIB with TBP. Dr1 can bind to DNA on its own. It is a component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4. |
| Protein Interactions |
Csrp2bp; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Dr1 (ARP31272_P050) antibody |
| Blocking Peptide |
For anti-Dr1 (ARP31272_P050) antibody is Catalog # AAP31272 |
| Uniprot ID |
Q91WV0 |
| Protein Name |
Protein Dr1 |
| Protein Accession # |
NP_080382 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_026106 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Dr1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Mouse Kidney
 | WB Suggested Anti-Dr1 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Kidney |
|
|
