Product Number |
ARP31220_P050 |
Product Page |
www.avivasysbio.com/pax2-antibody-middle-region-arp31220-p050.html |
Name |
PAX2 Antibody - middle region (ARP31220_P050) |
Protein Size (# AA) |
393 amino acids |
Molecular Weight |
42kDa |
NCBI Gene Id |
5076 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Alias Symbols |
FSGS7, PAPRS |
Peptide Sequence |
Synthetic peptide located within the following region: DPVGSYSINGILGIPRSNGEKRKRDEDVSEGSVPNGDSQSGVDSLRKHLR |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor supressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. |
Protein Interactions |
BBS7; BBS4; BBS2; BBS1; RB1; BRCA1; SFRP2; PAXIP1; WT1; MAPK8IP1; MAPK8; ID2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-PAX2 (ARP31220_P050) antibody |
Blocking Peptide |
For anti-PAX2 (ARP31220_P050) antibody is Catalog # AAP31220 |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Human PAX2 |
Uniprot ID |
Q02962 |
Protein Name |
Paired box protein Pax-2 Ensembl ENSP00000452527 |
Publications |
Hurtado, A. et al. Regulation of ERBB2 by oestrogen receptor-PAX2 determines response to tamoxifen. Nature 456, 663-6 (2008). 19005469
Lee, S. B. et al. PAX2 regulates ADAM10 expression and mediates anchorage-independent cell growth of melanoma cells. PLoS One 6, e22312 (2011). 21876729
Palmieri, C. et al. Expression of steroid receptor coactivator 3 in ovarian epithelial cancer is a poor prognostic factor and a marker for platinum resistance. Br. J. Cancer 108, 2039-44 (2013). 23652306
Viringipurampeer, I. A. et al. Pax2 regulates a fadd-dependent molecular switch that drives tissue fusion during eye development. Hum. Mol. Genet. 21, 2357-69 (2012). 22357656
Yu, A. L. et al. Hypoxia/reoxygenation and TGF-beta increase alphaB-crystallin expression in human optic nerve head astrocytes. Exp. Eye Res. 84, 694-706 (2007). 17261280
Yu, A. L. et al. Reactivation of optic nerve head astrocytes by TGF-beta2 and H2O2 is accompanied by increased Hsp32 and Hsp47 expression. Invest. Ophthalmol. Vis. Sci. 50, 1707-17 (2009). 18952926 |
Protein Accession # |
NP_000269 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_000278 |
Tested Species Reactivity |
Human |
Gene Symbol |
PAX2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100% |
Image 1 | Human Fetal Thymus
| Host: Rabbit Target Name: PAX2 Sample Type: Human Fetal Thymus Antibody Dilution: 1.0ug/ml |
|