PAX2 Antibody - middle region (ARP31220_P050)

Data Sheet
 
Product Number ARP31220_P050
Product Page www.avivasysbio.com/pax2-antibody-middle-region-arp31220-p050.html
Name PAX2 Antibody - middle region (ARP31220_P050)
Protein Size (# AA) 393 amino acids
Molecular Weight 42kDa
NCBI Gene Id 5076
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols FSGS7, PAPRS
Peptide Sequence Synthetic peptide located within the following region: DPVGSYSINGILGIPRSNGEKRKRDEDVSEGSVPNGDSQSGVDSLRKHLR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor supressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia.
Protein Interactions BBS7; BBS4; BBS2; BBS1; RB1; BRCA1; SFRP2; PAXIP1; WT1; MAPK8IP1; MAPK8; ID2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PAX2 (ARP31220_P050) antibody
Blocking Peptide For anti-PAX2 (ARP31220_P050) antibody is Catalog # AAP31220
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human PAX2
Uniprot ID Q02962
Protein Name Paired box protein Pax-2 Ensembl ENSP00000452527
Publications

Hurtado, A. et al. Regulation of ERBB2 by oestrogen receptor-PAX2 determines response to tamoxifen. Nature 456, 663-6 (2008). 19005469

Lee, S. B. et al. PAX2 regulates ADAM10 expression and mediates anchorage-independent cell growth of melanoma cells. PLoS One 6, e22312 (2011). 21876729

Palmieri, C. et al. Expression of steroid receptor coactivator 3 in ovarian epithelial cancer is a poor prognostic factor and a marker for platinum resistance. Br. J. Cancer 108, 2039-44 (2013). 23652306

Viringipurampeer, I. A. et al. Pax2 regulates a fadd-dependent molecular switch that drives tissue fusion during eye development. Hum. Mol. Genet. 21, 2357-69 (2012). 22357656

Yu, A. L. et al. Hypoxia/reoxygenation and TGF-beta increase alphaB-crystallin expression in human optic nerve head astrocytes. Exp. Eye Res. 84, 694-706 (2007). 17261280

Yu, A. L. et al. Reactivation of optic nerve head astrocytes by TGF-beta2 and H2O2 is accompanied by increased Hsp32 and Hsp47 expression. Invest. Ophthalmol. Vis. Sci. 50, 1707-17 (2009). 18952926

Protein Accession # NP_000269
Purification Affinity Purified
Nucleotide Accession # NM_000278
Tested Species Reactivity Human
Gene Symbol PAX2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Image 1
Human Fetal Thymus
Host: Rabbit
Target Name: PAX2
Sample Type: Human Fetal Thymus
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com