GABPB2 Antibody - middle region (ARP31189_P050)

• Product Number: ARP31189_P050
• Name: GABPB2 Antibody - middle region (ARP31189_P050)
• Protein Size (# AA): 395 amino acids
• Molecular Weight: 42kDa
• Subunit: beta-1
• NCBI Gene Id: 2553
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: GA binding protein transcription factor, beta subunit 1
• Alias Symbols: E4TF1, GABPB, BABPB2, E4TF1B, GABPB2, NRF2B1, NRF2B2, GABPB-1, E4TF1-47, E4TF1-53
• Peptide Sequence: Synthetic peptide located within the following region: EPPAKRQCIEIIENRVESAEIEEREALQKQLDEANREAQKYRQQLLKKEQ
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Crook,M.F., (2008) FASEB J. 22 (1), 225-235
• Description of Target: GABPB2 is the GA-binding protein transcription factor, beta subunit. This protein forms a tetrameric complex with the alpha subunit, and stimulates transcription of target genes. The protein may be involved in activation of cytochrome oxidase expression and nuclear control of mitochondrial function. The crystal structure of a similar protein in mouse has been resolved as a ternary protein complex. Multiple transcript variants encoding distinct isoforms have been identified for this gene.This gene encodes the GA-binding protein transcription factor, beta subunit. This protein forms a tetrameric complex with the alpha subunit, and stimulates transcription of target genes. The encoded protein may be involved in activation of cytochrome oxidase expression and nuclear control of mitochondrial function. The crystal structure of a similar protein in mouse has been resolved as a ternary protein complex. Multiple transcript variants encoding distinct isoforms have been identified for this gene.
• Protein Interactions: FAM90A1; RBM11; RSPH14; TDRD7; POGZ; LMO4; TRAF2; SNRPB2; SNRPA; LMO1; UBC; MAGEB18; RYBP; YAF2; YY1; GABPA; IL16; DHX16; CIC; LMO3; USO1; FANCG; BAI2; HCFC1; ATF1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-GABPB1 (ARP31189_P050) antibody is Catalog # AAP31189 (Previous Catalog # AAPP24041)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GABPB2
• Uniprot ID: Q06547
• Protein Name: GA-binding protein subunit beta-1
• Sample Type Confirmation:

  GABPB1 is strongly supported by BioGPS gene expression data to be expressed in HeLa

• Protein Accession #: NP_005245
• Purification: Affinity Purified
• Nucleotide Accession #: NM_005254
• Tested Species Reactivity: Human
• Gene Symbol: GABPB1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Image 1: Human HeLa
  
  WB Suggested Anti-GABPB2 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: Hela cell lysateGABPB1 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells