STAT6 Antibody - C-terminal region (ARP31048_P050)

Data Sheet
Product Number ARP31048_P050
Product Page
Name STAT6 Antibody - C-terminal region (ARP31048_P050)
Gene Symbol STAT6
Alias Symbols D12S1644, IL-4-STAT, STAT6B, STAT6C
Protein Size (# AA) 847 amino acids
Molecular Weight 94kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 6778
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Signal transducer and activator of transcription 6, interleukin-4 induced
Peptide Sequence Synthetic peptide located within the following region: NLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPELQM
Target Reference Li,B.H., (2008) Biochem. Biophys. Res. Commun. 369 (2), 554-560
Description of Target Full-length human STAR6 (NP_003144) was expressed in E.coli as inclusion body and purified after protein refolding for mouse immunization. Clone 5B1 shows excellent western blot detection of endogenous STAT6 using ACHN cell lysate.The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL4. Knockout studies in mice suggested the roles of this gene in differentiation of T helper 2 (Th2) cells, expression of cell surface markers, and class switch of immunoglobulins. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-STAT6 (ARP31048_P050) antibody
Additional Information IHC Information: Human Kidney: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Human Prostate: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Human Testis: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Human Tonsil: Formalin-Fixed, Paraffin-Embedded (FFPE)
Blocking Peptide For anti-STAT6 (ARP31048_P050) antibody is Catalog # AAP31048 (Previous Catalog # AAPP24027)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human STAT6
Complete computational species homology data Anti-STAT6 (ARP31048_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express STAT6.
Swissprot Id P42226
Protein Name Signal transducer and activator of transcription 6
Sample Type Confirmation

STAT6 is strongly supported by BioGPS gene expression data to be expressed in HeLa

Protein Accession # NP_003144
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express STAT6.
Nucleotide Accession # NM_003153
Replacement Item This antibody may replace item sc-117401 from Santa Cruz Biotechnology.
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Application WB, IHC
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Tonsil
Human Tonsil
Image 2
Human Testis
Human Testis
Image 3
Human Prostate
Human Prostate
Image 4
Human Kidney
Human Kidney
Image 5
Human Lung Tissue
STAT6 antibody - C-terminal region (ARP31048_P050)
Catalog Number: ARP31048_P050
Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue
Observed Staining: Cytoplasm of pneumocytes
Primary Antibody Concentration: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
Image 6
Human HeLa
WB Suggested Anti-STAT6 Antibody Titration: 1 ug/ml
Positive Control: Hela cell lysateSTAT6 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 |