| Product Number |
ARP30991_P050 |
| Product Page |
www.avivasysbio.com/dmrt1-antibody-middle-region-arp30991-p050.html |
| Name |
DMRT1 Antibody - middle region (ARP30991_P050) |
| Protein Size (# AA) |
215 amino acids |
| Molecular Weight |
23kDa |
| NCBI Gene Id |
1761 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
doublesex and mab-3 related transcription factor 1 |
| Alias Symbols |
DMT1, CT154 |
| Peptide Sequence |
Synthetic peptide located within the following region: GSPVKNSLRGLPGPYVPGQTGNQWQMKNMENRHAMSSQYRMHSYYPPPSY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene is found in a cluster with two other members of the gene family, having in common a zinc finger-like DNA-binding motif (DM domain). The DM domain is an ancient, conserved component of the vertebrate sex-determining pathway that is also a key regulator of male development in flies and nematodes. This gene exhibits a gonad-specific and sexually dimorphic expression pattern. Defective testicular development and XY feminization occur when this gene is hemizygous. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-DMRT1 (ARP30991_P050) antibody |
| Blocking Peptide |
For anti-DMRT1 (ARP30991_P050) antibody is Catalog # AAP30991 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human DMRT1 |
| Uniprot ID |
Q9Y5R6 |
| Protein Name |
doublesex- and mab-3-related transcription factor 1 |
| Publications |
Tezak, B., I. Romero, S. Milton and J. Wyneken. Identifying Sex of Neonate Turtles with Temperature-dependent Sex Determination via Small Blood Samples. Sci Rep. 2020
10: 5012. 32193464 |
| Protein Accession # |
NP_068770.2 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_021951.2 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
DMRT1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 77%; Rabbit: 92%; Rat: 92% |
| Image 1 | Human Esophagus Tumor
 | Host: Rabbit
Target Name: DMRT1
Sample Type: Esophagus Tumor lysates
Antibody Dilution: 1.0ug/ml |
|
|
