Arnt Antibody - C-terminal region : FITC (ARP30979_P050-FITC)

Data Sheet
 
Product Number ARP30979_P050-FITC
Product Page www.avivasysbio.com/arnt-antibody-c-terminal-region-fitc-arp30979-p050-fitc.html
Name Arnt Antibody - C-terminal region : FITC (ARP30979_P050-FITC)
Protein Size (# AA) 800 amino acids
Molecular Weight 88kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 25242
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Aryl hydrocarbon receptor nuclear translocator
Alias Symbols Arnt1
Peptide Sequence Synthetic peptide located within the following region: SNEQHVQPTSAQPSSQPEVFQEMLSMLGDQSNTYNNEEFPDLTMFPPFSE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target Arnt is required for activity of the Ah (dioxin) receptor. This protein is required for the ligand-binding subunit to translocate from the cytosol to the nucleus after ligand binding. The complex then initiates transcription of genes involved in the activation of PAH procarcinogens. The heterodimer with HIF1A or EPAS1/HIF2A functions as a transcriptional regulator of the adaptive response to hypoxia.
Protein Interactions Ahr;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-Arnt (ARP30979_P050-FITC) antibody
Blocking Peptide For anti-Arnt (ARP30979_P050-FITC) antibody is Catalog # AAP30979 (Previous Catalog # AAPS08305)
Immunogen The immunogen is a synthetic peptide corresponding to a region of Rat
Uniprot ID P41739
Protein Name Aryl hydrocarbon receptor nuclear translocator
Protein Accession # NP_036912
Purification Affinity Purified
Nucleotide Accession # NM_012780
Gene Symbol Arnt
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 100%; Sheep: 100%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com