Product Number |
ARP30979_P050 |
Product Page |
www.avivasysbio.com/arnt-antibody-c-terminal-region-arp30979-p050.html |
Name |
Arnt Antibody - C-terminal region (ARP30979_P050) |
Protein Size (# AA) |
800 amino acids |
Molecular Weight |
88kDa |
NCBI Gene Id |
25242 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Aryl hydrocarbon receptor nuclear translocator |
Alias Symbols |
Arnt1 |
Peptide Sequence |
Synthetic peptide located within the following region: SNEQHVQPTSAQPSSQPEVFQEMLSMLGDQSNTYNNEEFPDLTMFPPFSE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
Arnt is required for activity of the Ah (dioxin) receptor. This protein is required for the ligand-binding subunit to translocate from the cytosol to the nucleus after ligand binding. The complex then initiates transcription of genes involved in the activation of PAH procarcinogens. The heterodimer with HIF1A or EPAS1/HIF2A functions as a transcriptional regulator of the adaptive response to hypoxia. |
Protein Interactions |
Ahr; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Arnt (ARP30979_P050) antibody |
Blocking Peptide |
For anti-Arnt (ARP30979_P050) antibody is Catalog # AAP30979 (Previous Catalog # AAPS08305) |
Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Rat |
Uniprot ID |
P41739 |
Protein Name |
Aryl hydrocarbon receptor nuclear translocator |
Publications |
Human placental renin-angiotensin system in normotensive and pre-eclamptic pregnancies at high altitude and after acute hypoxia-reoxygenation insult. J. Physiol. (Lond.). 26574162 |
Protein Accession # |
NP_036912 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_012780 |
Tested Species Reactivity |
Human, Rat |
Gene Symbol |
Arnt |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep |
Application |
WB, IHC |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 100%; Sheep: 100% |
Image 1 | Rat Liver
| WB Suggested Anti-Arnt Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Rat Liver |
|
Image 2 | Human placenta
| Researcher: Hiten D. Mistry, King's College London
Application: IHC
Species + Tissue/Cell type: Human placenta
Primary antibody dilution: 1:200
Secondary antibody: Anti-rabbit-HRP
Secondary antibody dilution: 1:5000 |
|