Arnt Antibody - C-terminal region (ARP30979_P050)

Data Sheet
 
Product Number ARP30979_P050
Product Page www.avivasysbio.com/arnt-antibody-c-terminal-region-arp30979-p050.html
Name Arnt Antibody - C-terminal region (ARP30979_P050)
Protein Size (# AA) 800 amino acids
Molecular Weight 88kDa
NCBI Gene Id 25242
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Aryl hydrocarbon receptor nuclear translocator
Alias Symbols Arnt1
Peptide Sequence Synthetic peptide located within the following region: SNEQHVQPTSAQPSSQPEVFQEMLSMLGDQSNTYNNEEFPDLTMFPPFSE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Arnt is required for activity of the Ah (dioxin) receptor. This protein is required for the ligand-binding subunit to translocate from the cytosol to the nucleus after ligand binding. The complex then initiates transcription of genes involved in the activation of PAH procarcinogens. The heterodimer with HIF1A or EPAS1/HIF2A functions as a transcriptional regulator of the adaptive response to hypoxia.
Protein Interactions Ahr;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Arnt (ARP30979_P050) antibody
Blocking Peptide For anti-Arnt (ARP30979_P050) antibody is Catalog # AAP30979 (Previous Catalog # AAPS08305)
Immunogen The immunogen is a synthetic peptide corresponding to a region of Rat
Uniprot ID P41739
Protein Name Aryl hydrocarbon receptor nuclear translocator
Publications

Human placental renin-angiotensin system in normotensive and pre-eclamptic pregnancies at high altitude and after acute hypoxia-reoxygenation insult. J. Physiol. (Lond.). 26574162

Protein Accession # NP_036912
Purification Affinity Purified
Nucleotide Accession # NM_012780
Tested Species Reactivity Human, Rat
Gene Symbol Arnt
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
Application WB, IHC
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 100%; Sheep: 100%
Image 1
Rat Liver
WB Suggested Anti-Arnt Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Rat Liver
Image 2
Human placenta
Researcher: Hiten D. Mistry, King's College London
Application: IHC
Species + Tissue/Cell type: Human placenta
Primary antibody dilution: 1:200
Secondary antibody: Anti-rabbit-HRP
Secondary antibody dilution: 1:5000
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com