AR Antibody - N-terminal region (ARP30974_P050)

• Product Number: ARP30974_P050
• Name: AR Antibody - N-terminal region (ARP30974_P050)
• Protein Size (# AA): 920 amino acids
• Molecular Weight: 99kDa
• NCBI Gene Id: 367
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Androgen receptor
• Alias Symbols: KD, AIS, AR8, TFM, DHTR, SBMA, HYSP1, NR3C4, SMAX1, HUMARA
• Peptide Sequence: Synthetic peptide located within the following region: MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Hsu,F.C., (2008) Cancer Genet. Cytogenet. 183 (2), 94-98
• Description of Target: AR has 3 major functional domains: the N-terminal domain, DNA-binding domain, and androgen-binding domain. The protein functions as a steroid-hormone activated transcription factor. Upon binding the hormone ligand, the receptor dissociates from accessory proteins, translocates into the nucleus, dimerizes, and then stimulates transcription of androgen responsive genes. This gene contains 2 polymorphic trinucleotide repeat segments that encode polyglutamine and polyglycine tracts in the N-terminal transactivation domain of its protein. Expansion of the polyglutamine tract causes spinal bulbar muscular atrophy (Kennedy disease). Mutations in this gene are also associated with complete androgen insensitivity (CAIS).The androgen receptor gene is more than 90 kb long and codes for a protein that has 3 major functional domains: the N-terminal domain, DNA-binding domain, and androgen-binding domain. The protein functions as a steroid-hormone activated transcription factor. Upon binding the hormone ligand, the receptor dissociates from accessory proteins, translocates into the nucleus, dimerizes, and then stimulates transcription of androgen responsive genes. This gene contains 2 polymorphic trinucleotide repeat segments that encode polyglutamine and polyglycine tracts in the N-terminal transactivation domain of its protein. Expansion of the polyglutamine tract causes spinal bulbar muscular atrophy (Kennedy disease). Mutations in this gene are also associated with complete androgen insensitivity (CAIS). Two alternatively spliced variants encoding distinct isoforms have been described.
• Protein Interactions: AATF; SPOP; UBC; TSG101; TAF1; EP300; DAPK3; USP12; TTC5; SIRT1; RNF6; MAGEA11; VCP; KIF1A; NSD1; WIPI1; NDE1; NCOA1; REL; SMAD1; WDR77; AR; RANBP9; VHL; SKP2; RNF14; EZH2; BMI1; DCAF6; SUZ12; EED; RNF2; RBL1; PTGES3; NCOA4; SUMO2; CUL2; UXT; TCF4; ACTB;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-AR (ARP30974_P050) antibody is Catalog # AAP30974 (Previous Catalog # AAPP24017)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AR
• Uniprot ID: P10275
• Protein Name: Androgen receptor
• Protein Accession #: NP_000035
• Purification: Affinity Purified
• Nucleotide Accession #: NM_000044
• Tested Species Reactivity: Human
• Gene Symbol: AR
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 86%; Rat: 93%; Sheep: 86%
• Image 1: Human Fetal Lung
  
  Host: Rabbit
  Target Name: AR
  Sample Type: Human Fetal Lung
  Antibody Dilution: 1.0ug/ml
• Image 2: Human Jurkat
  
  WB Suggested Anti-AR Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: Jurkat cell lysate