CXCR4 Antibody - N-terminal region (ARP30799_P050)

Data Sheet
 
Product Number ARP30799_P050
Product Page www.avivasysbio.com/cxcr4-antibody-n-terminal-region-arp30799-p050.html
Name CXCR4 Antibody - N-terminal region (ARP30799_P050)
Protein Size (# AA) 352 amino acids
Molecular Weight 40 kDa
NCBI Gene Id 7852
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Chemokine (C-X-C motif) receptor 4
Description
Alias Symbols FB22, HM89, LAP3, LCR1, NPYR, WHIM, CD184, LAP-3, LESTR, NPY3R, NPYRL, WHIMS, HSY3RR, NPYY3R, D2S201E
Peptide Sequence Synthetic peptide located within the following region: MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Yoshitake,N., (2008) Br. J. Cancer 98 (10), 1682-1689
Description of Target CXCR4 is a CXC chemokine receptor specific for stromal cell-derived factor-1. The protein has 7 transmembrane regions and is located on the cell surface. It acts with the CD4 protein to support HIV entry into cells and is also highly expressed in breast cancer cells. Mutations in this gene have been associated with WHIM (warts, hypogammaglobulinemia, infections, and myelokathexis) syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.This gene encodes a CXC chemokine receptor specific for stromal cell-derived factor-1. The protein has 7 transmembrane regions and is located on the cell surface. It acts with the CD4 protein to support HIV entry into cells and is also highly expressed in breast cancer cells. Mutations in this gene have been associated with WHIM (warts, hypogammaglobulinemia, infections, and myelokathexis) syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Protein Interactions UBC; ITCH; nef; P4HB; CD4; env; MYBL2; ST13; ATP13A2; CXCL12; PTPN11; STAM; CAV1; SUMO4; HLA-C; SDC4; HSPA8; GNA13; STAT5B; SOCS3; SOCS1; CCR5; PTK2; STAT2; STAT1; JAK3; DPP4; PTPN6; VAV1; CXCR4; MYH9; PTPRC; JAK2; JAK1; GNAI1; ELANE; CTSG; ADRBK2; ARRB2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CXCR4 (ARP30799_P050) antibody
Blocking Peptide For anti-CXCR4 (ARP30799_P050) antibody is Catalog # AAP30799 (Previous Catalog # AAPS08210)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CXCR4
Uniprot ID P61073
Protein Name C-X-C chemokine receptor type 4
Publications

Biopolymer-delivered vascular endothelial growth factor improves renal outcomes following revascularization. Am J Physiol Renal Physiol. 316, F1016-F1025 (2019). 30892933

Protein Accession # NP_003458
Purification Affinity Purified
Nucleotide Accession # NM_003467
Tested Species Reactivity Human, Mouse
Gene Symbol CXCR4
Predicted Species Reactivity Human, Mouse, Horse, Pig, Rabbit
Application FC, IHC, WB
Predicted Homology Based on Immunogen Sequence Horse: 89%; Human: 91%; Mouse: 77%; Pig: 91%; Rabbit: 85%; Rat: 77%
Image 1
Human 721_B
WB Suggested Anti-CXCR4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate
Image 2
Human endothelial
CXCR4 antibody - N-terminal region (ARP30799_P050) validated by WB using human microvascular endothelial cells (25ug) at 1:1000.
Image 3
Human 721_B
CXCR4 antibody - N-terminal region (ARP30799_P050) validated by WB using 721_B cell Lysate at 0.2-1 ug/ml.
Image 4
Human HMEC-1, A549
Immunohistochemistry with HMEC-1 and A549 cells tissue
Image 5
Human HMEC-1, A549
Sample Type: human colon tissues infected ex-vivo with HIV-1
Green: Primary
Blue: DAPI
Primary Dilution: 1:100
Secondary Antibody: Donkey anti-Rabbit AF 488
Secondary Dilution: 1:500
Image Submitted By: Chiara Foglieni
San Raffaele Scientific Institute, Milan, Italy 
Image 6
Human MCF7 Whole Cell
Host: Rabbit
Target Name: CXCR4
Sample Tissue: Human MCF7 Whole Cell
Antibody Dilution: 1ug/ml
Image 7
Human HMEC-1, A549
Sample Type: HMEC-1 and A549 cells.
Cell Lines: 3201 are feline B lymphocyte cell line positive for CXCR4. The PBMCs used here are feline and should be negative or very low for CXCR4. HSB2 are a human T cell lymphoblastoid cell line positive for CXCR4. Jurkat are an immortalized human T lymphocytes that are positive for CXCR4.
Image 8
Mouse brain extract
WB Suggested Anti-CXCR4 Antibody
Positive Control: Lane 1: 20ug mouse brain extract Lane 2: 20ug mouse brain extract
Primary Antibody Dilution : 1:500
Secondary Antibody : Anti rabbit-HRP
Secondry Antibody Dilution : 1:5,000
Submitted by: Scott Wilson, University of Alabama at Birmingham
Image 9

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com