HTR2B Antibody - N-terminal region (ARP30716_P050)

• Product Number: ARP30716_P050
• Name: HTR2B Antibody - N-terminal region (ARP30716_P050)
• Protein Size (# AA): 481 amino acids
• Molecular Weight: 54 kDa
• NCBI Gene Id: 3357
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: 5-hydroxytryptamine (serotonin) receptor 2B, G protein-coupled
• Alias Symbols: 5-HT2B, 5-HT-2B, 5-HT(2B)
• Peptide Sequence: Synthetic peptide located within the following region: QTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: Multiple receptor subtypes of serotonin neurotransmitters with multiple physiologic functions have been recognized. The 5-HT-2 receptors mediate many of the central and peripheral physiologic functions of serotonin. Cardiovascular effects include contraction of blood vessels and shape changes in platelets; central nervous system effects include neuronal sensitization to tactile stimuli and mediation of hallucinogenic effects of phenylisopropylamine hallucinogens.
• Protein Interactions: AGTR1; SNTA1; LNX1; GNAQ; GNA11;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Other Applications Image 1 Data: Immunofluorescence-- 1.3ug/mL
• Blocking Peptide: For anti-HTR2B (ARP30716_P050) antibody is Catalog # AAP30716 (Previous Catalog # AAPP01373)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HTR2B
• Uniprot ID: P41595
• Protein Name: 5-hydroxytryptamine receptor 2B
• Sample Type Confirmation:

  HTR2B is supported by BioGPS gene expression data to be expressed in 721_B

• Protein Accession #: NP_000858
• Purification: Affinity Purified
• Nucleotide Accession #: NM_000867
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: HTR2B
• Predicted Species Reactivity: Human, Cow, Dog, Guinea Pig, Horse, Pig
• Application: IF, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 80%; Guinea Pig: 85%; Horse: 93%; Human: 100%; Pig: 87%
• Image 1: Human Adult Placenta
  
  Host: Rabbit
  Target Name: HTR2B
  Sample Type: Human Adult Placenta
  Antibody Dilution: 1.0ug/ml
• Image 2: Human Fetal Muscle
  
  Host: Rabbit
  Target Name: HTR2B
  Sample Type: Human Fetal Muscle
  Antibody Dilution: 1.0ug/ml
• Image 3: Human Fetal Lung
  
  Host: Rabbit
  Target Name: HTR2B
  Sample Type: Human Fetal Lung
  Antibody Dilution: 1.0ug/ml
• Image 4: Mouse Spinal Cord
  
  Immunofluorescence: 1.3ug/mL
• Image 5: Human PANC1 Whole Cell
  
  Host: Rabbit
  Target Name: HTR2B
  Sample Tissue: Human PANC1 Whole Cell
  Antibody Dilution: 1ug/ml