DYRK3 Antibody - N-terminal region (ARP30647_P050)

Data Sheet
 
Product Number ARP30647_P050
Product Page www.avivasysbio.com/dyrk3-antibody-n-terminal-region-arp30647-p050.html
Name DYRK3 Antibody - N-terminal region (ARP30647_P050)
Protein Size (# AA) 568 amino acids
Molecular Weight 64kDa
NCBI Gene Id 8444
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3
Description
Alias Symbols RED, REDK, DYRK5, hYAK3-2
Peptide Sequence Synthetic peptide located within the following region: EPPPPRRLNMTTEQFTGDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQSDG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene product belongs to the DYRK family of dual-specificity protein kinases that catalyze autophosphorylation on serine/threonine and tyrosine residues. The members of this family share structural similarity, however, differ in their substrate specificity, suggesting their involvement in different cellular functions. The encoded protein has been shown to autophosphorylate on tyrosine residue and catalyze phosphorylation of histones H3 and H2B in vitro. Alternatively spliced transcript variants encoding different isoforms have been identified.
Protein Interactions DYRK3; SORL1; FBXO25; PRNP; NEDD4L;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-DYRK3 (ARP30647_P050) antibody
Blocking Peptide For anti-DYRK3 (ARP30647_P050) antibody is Catalog # AAP30647 (Previous Catalog # AAPP01304)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human DYRK3
Uniprot ID D3DT79
Protein Name Dual specificity tyrosine-phosphorylation-regulated kinase 3
Publications

Hsp90-mediated regulation of DYRK3 couples stress granule disassembly and growth via mTORC1 signaling. EMBO Rep. 22, e51740 (2021). 33738926

Sample Type Confirmation

DYRK3 is supported by BioGPS gene expression data to be expressed in HT1080

Protein Accession # NP_001004023
Purification Affinity Purified
Nucleotide Accession # NM_001004023
Tested Species Reactivity Human
Gene Symbol DYRK3
Predicted Species Reactivity Human, Rat, Guinea Pig, Yeast
Application WB
Predicted Homology Based on Immunogen Sequence Guinea Pig: 83%; Human: 100%; Rat: 90%; Yeast: 80%
Image 1
Human HT1080
WB Suggested Anti-DYRK3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HT1080 cell lysateDYRK3 is supported by BioGPS gene expression data to be expressed in HT1080
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com