Product Number |
ARP30647_P050 |
Product Page |
www.avivasysbio.com/dyrk3-antibody-n-terminal-region-arp30647-p050.html |
Name |
DYRK3 Antibody - N-terminal region (ARP30647_P050) |
Protein Size (# AA) |
568 amino acids |
Molecular Weight |
64kDa |
NCBI Gene Id |
8444 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3 |
Description |
|
Alias Symbols |
RED, REDK, DYRK5, hYAK3-2 |
Peptide Sequence |
Synthetic peptide located within the following region: EPPPPRRLNMTTEQFTGDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQSDG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
This gene product belongs to the DYRK family of dual-specificity protein kinases that catalyze autophosphorylation on serine/threonine and tyrosine residues. The members of this family share structural similarity, however, differ in their substrate specificity, suggesting their involvement in different cellular functions. The encoded protein has been shown to autophosphorylate on tyrosine residue and catalyze phosphorylation of histones H3 and H2B in vitro. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Protein Interactions |
DYRK3; SORL1; FBXO25; PRNP; NEDD4L; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-DYRK3 (ARP30647_P050) antibody |
Blocking Peptide |
For anti-DYRK3 (ARP30647_P050) antibody is Catalog # AAP30647 (Previous Catalog # AAPP01304) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human DYRK3 |
Uniprot ID |
D3DT79 |
Protein Name |
Dual specificity tyrosine-phosphorylation-regulated kinase 3 |
Publications |
Hsp90-mediated regulation of DYRK3 couples stress granule disassembly and growth via mTORC1 signaling. EMBO Rep. 22, e51740 (2021). 33738926 |
Sample Type Confirmation |
DYRK3 is supported by BioGPS gene expression data to be expressed in HT1080 |
Protein Accession # |
NP_001004023 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001004023 |
Tested Species Reactivity |
Human |
Gene Symbol |
DYRK3 |
Predicted Species Reactivity |
Human, Rat, Guinea Pig, Yeast |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Guinea Pig: 83%; Human: 100%; Rat: 90%; Yeast: 80% |
Image 1 | Human HT1080
| WB Suggested Anti-DYRK3 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: HT1080 cell lysateDYRK3 is supported by BioGPS gene expression data to be expressed in HT1080 |
|