Product Number |
ARP30643_P050 |
Product Page |
www.avivasysbio.com/ywhag-antibody-n-terminal-region-arp30643-p050.html |
Name |
Ywhag Antibody - N-terminal region (ARP30643_P050) |
Protein Size (# AA) |
247 amino acids |
Molecular Weight |
28kDa |
NCBI Gene Id |
22628 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide |
Alias Symbols |
D7Bwg1348e, 14-3-3gamma |
Peptide Sequence |
Synthetic peptide located within the following region: EERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKI |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
Ywhag is an adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Ywhag binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Ywhag binding generally results in the modulation of the activity of the binding partner. |
Protein Interactions |
Mapt; Kcnma1; Mdm4; Eed; CALM1; Fbxo32; Rara; Rpgrip1l; Ywhaz; Mark3; Mark2; Nedd4l; Htt; Lrrk2; Crk; Ywhae; Lmna; SNCA; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Ywhag (ARP30643_P050) antibody |
Blocking Peptide |
For anti-Ywhag (ARP30643_P050) antibody is Catalog # AAP30643 |
Uniprot ID |
P61982 |
Protein Name |
14-3-3 protein gamma |
Protein Accession # |
NP_061359 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_018871 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
Ywhag |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Image 1 | Mouse Brain
| WB Suggested Anti-Ywhag Antibody Titration: 1.0 ug/ml Positive Control: Mouse Brain |
|
|