Ywhag Antibody - N-terminal region (ARP30643_P050)

Data Sheet
 
Product Number ARP30643_P050
Product Page www.avivasysbio.com/ywhag-antibody-n-terminal-region-arp30643-p050.html
Name Ywhag Antibody - N-terminal region (ARP30643_P050)
Protein Size (# AA) 247 amino acids
Molecular Weight 28kDa
NCBI Gene Id 22628
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide
Alias Symbols D7Bwg1348e, 14-3-3gamma
Peptide Sequence Synthetic peptide located within the following region: EERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Ywhag is an adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Ywhag binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Ywhag binding generally results in the modulation of the activity of the binding partner.
Protein Interactions Mapt; Kcnma1; Mdm4; Eed; CALM1; Fbxo32; Rara; Rpgrip1l; Ywhaz; Mark3; Mark2; Nedd4l; Htt; Lrrk2; Crk; Ywhae; Lmna; SNCA;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Ywhag (ARP30643_P050) antibody
Blocking Peptide For anti-Ywhag (ARP30643_P050) antibody is Catalog # AAP30643
Uniprot ID P61982
Protein Name 14-3-3 protein gamma
Protein Accession # NP_061359
Purification Affinity Purified
Nucleotide Accession # NM_018871
Tested Species Reactivity Mouse
Gene Symbol Ywhag
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Mouse Brain
WB Suggested Anti-Ywhag Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Brain
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com