Product Number |
ARP30639_P050 |
Product Page |
www.avivasysbio.com/sumo1-antibody-n-terminal-region-arp30639-p050.html |
Name |
Sumo1 Antibody - N-terminal region (ARP30639_P050) |
Protein Size (# AA) |
101 amino acids |
Molecular Weight |
11kDa |
NCBI Gene Id |
22218 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
SMT3 suppressor of mif two 3 homolog 1 (yeast) |
Alias Symbols |
PI, SE, Ubl, GMP1, PIC1, SMT3, Ubl1, SMTP3, Smt3C, SMT3H3, SUMO-1, SENTRIN |
Peptide Sequence |
Synthetic peptide located within the following region: DQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYC |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
Ubiquitin-like protein that can be covalently attached to proteins as a monomer or a lysine-linked polymer. Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by E3 ligases such as PIAS1-4, RANBP2 or CBX4. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. It is involved for instance in targeting RANGAP1 to the nuclear pore complex protein RANBP2. Polymeric SUMO1 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins. It may also regulate a network of genes involved in palate development. |
Protein Interactions |
Pten; Stat1; Pml; Casp8ap2; Traf3; Pik3c3; Npm1; Mdm2; Ube2i; Trp53; Rangap1; Ranbp2; Mthfs; Sox2; Senp2; Rbbp7; Slc1a2; Uimc1; Nfatc2ip; Irf1; Irf8; Smad4; BCL11A; AXIN1; Myb; Pax6; Sept2; Daxx; Sf1; Sp3; Pou5f1; Hif1a; Nfkb2; Junb; Jun; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Sumo1 (ARP30639_P050) antibody |
Blocking Peptide |
For anti-Sumo1 (ARP30639_P050) antibody is Catalog # AAP30639 (Previous Catalog # AAPP01292) |
Uniprot ID |
P63166 |
Protein Name |
Small ubiquitin-related modifier 1 |
Protein Accession # |
NP_033486 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_009460 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
Sumo1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Mouse Thymus
| WB Suggested Anti-Sumo1 Antibody Titration: 1.0 ug/ml Positive Control: Mouse Thymus |
|
|