Sumo1 Antibody - N-terminal region (ARP30639_P050)

Data Sheet
 
Product Number ARP30639_P050
Product Page www.avivasysbio.com/sumo1-antibody-n-terminal-region-arp30639-p050.html
Name Sumo1 Antibody - N-terminal region (ARP30639_P050)
Protein Size (# AA) 101 amino acids
Molecular Weight 11kDa
NCBI Gene Id 22218
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name SMT3 suppressor of mif two 3 homolog 1 (yeast)
Alias Symbols PI, SE, Ubl, GMP1, PIC1, SMT3, Ubl1, SMTP3, Smt3C, SMT3H3, SUMO-1, SENTRIN
Peptide Sequence Synthetic peptide located within the following region: DQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYC
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Ubiquitin-like protein that can be covalently attached to proteins as a monomer or a lysine-linked polymer. Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by E3 ligases such as PIAS1-4, RANBP2 or CBX4. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. It is involved for instance in targeting RANGAP1 to the nuclear pore complex protein RANBP2. Polymeric SUMO1 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins. It may also regulate a network of genes involved in palate development.
Protein Interactions Pten; Stat1; Pml; Casp8ap2; Traf3; Pik3c3; Npm1; Mdm2; Ube2i; Trp53; Rangap1; Ranbp2; Mthfs; Sox2; Senp2; Rbbp7; Slc1a2; Uimc1; Nfatc2ip; Irf1; Irf8; Smad4; BCL11A; AXIN1; Myb; Pax6; Sept2; Daxx; Sf1; Sp3; Pou5f1; Hif1a; Nfkb2; Junb; Jun;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Sumo1 (ARP30639_P050) antibody
Blocking Peptide For anti-Sumo1 (ARP30639_P050) antibody is Catalog # AAP30639 (Previous Catalog # AAPP01292)
Uniprot ID P63166
Protein Name Small ubiquitin-related modifier 1
Protein Accession # NP_033486
Purification Affinity Purified
Nucleotide Accession # NM_009460
Tested Species Reactivity Mouse
Gene Symbol Sumo1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Mouse Thymus
WB Suggested Anti-Sumo1 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Thymus
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com