CYR61 Antibody - middle region (ARP30565_T100)

• Product Number: ARP30565_T100
• Name: CYR61 Antibody - middle region (ARP30565_T100)
• Protein Size (# AA): 381 amino acids
• Molecular Weight: 41kDa
• NCBI Gene Id: 3491
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Alias Symbols: GIG1, CYR61, IGFBP10
• Peptide Sequence: Synthetic peptide located within the following region: CEYNSRIYQNGESFQPNCKHQCTCIDGAVGCIPLCPQELSLPNLGCPNPR
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The secreted protein encoded by this gene is growth factor-inducible and promotes the adhesion of endothelial cells. The encoded protein interacts with several integrins and with heparan sulfate proteoglycan. This protein also plays a role in cell proliferation, differentiation, angiogenesis, apoptosis, and extracellular matrix formation.
• Protein Interactions: UBC; SOX2; UBD; YWHAZ; Mis12; ZWINT; MYC; ITGAV; ITGB5;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CYR61 (ARP30565_T100) antibody is Catalog # AAP30565
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human CYR61
• Uniprot ID: Q6FI18
• Protein Accession #: NP_001545
• Nucleotide Accession #: NM_001554
• Tested Species Reactivity: Human
• Gene Symbol: CYR61
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Image 1: Human COLO205
  
  Host: Rabbit
  Target Name: CYR61
  Sample Type: COLO205 Whole Cell lysates
  Antibody Dilution: 3.0ug/ml