BCL2L1 Antibody - N-terminal region (ARP30475_T100)

Data Sheet
 
Product Number ARP30475_T100
Product Page www.avivasysbio.com/bcl2l1-antibody-n-terminal-region-arp30475-t100.html
Name BCL2L1 Antibody - N-terminal region (ARP30475_T100)
Protein Size (# AA) 233 amino acids
Molecular Weight 26kDa
NCBI Gene Id 598
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name BCL2-like 1
Alias Symbols BCLX, BCL2L, Bcl-X, PPP1R52, BCL-XL/S
Peptide Sequence Synthetic peptide located within the following region: SNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAING
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Allikmets,R., (2006) J. Mol. Biol. 356 (2), 367-381
Description of Target BCL2L1 encodes a protein which belongs to the BCL-2 protein family. The proteins encoded by BCL2L1 are located at the outer mitochondrial membrane, and have been shown to regulate outer mitochondrial membrane channel (VDAC) opening. VDAC regulates mitochondrial membrane potential, and thus controls the production of reactive oxygen species and release of cytochrome C by mitochondria, both of which are the potent inducers of cell apoptosis.The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The proteins encoded by this gene are located at the outer mitochondrial membrane, and have been shown to regulate outer mitochondrial membrane channel (VDAC) opening. VDAC regulates mitochondrial membrane potential, and thus controls the production of reactive oxygen species and release of cytochrome C by mitochondria, both of which are the potent inducers of cell apoptosis. Two alternatively spliced transcript variants, which encode distinct isoforms, have been reported. The longer isoform acts as an apoptotic inhibitor and the shorter form acts as an apoptotic activator.
Protein Interactions BCL2L1; BCL2; BAX; BAD; BMF; BBC3; CASP8AP2; BECN1; UBC; TPT1; TP53BP2; ced-9; ced-4; PGAM5; CDKN2A; CASP1; BCL2L11; HRK; PMAIP1; BIK; BID; PARK2; PINK1; BAK1; RAD9A; AKT1; Mapk1; ATXN3; CLU; BCAP31; CRYAB; CRYAA; BFAR; PPP1CC; PPP1CA; ACTB; UBR1; METTL23
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-BCL2L1 (ARP30475_T100) antibody
Blocking Peptide For anti-BCL2L1 (ARP30475_T100) antibody is Catalog # AAP30475 (Previous Catalog # AAPP24055)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human BCL2L1
Uniprot ID Q07817
Protein Name Bcl-2-like protein 1
Sample Type Confirmation

BCL2L1 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_612815
Purification Protein A purified
Nucleotide Accession # NM_138578
Tested Species Reactivity Human
Gene Symbol BCL2L1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 100%; Rat: 93%; Sheep: 100%
Image 1
Human HepG2
WB Suggested Anti-BCL2L1 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysateBCL2L1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com