Product Number |
ARP30370_P050 |
Product Page |
www.avivasysbio.com/tp53-antibody-n-terminal-region-arp30370-p050.html |
Name |
TP53 Antibody - N-terminal region (ARP30370_P050) |
Protein Size (# AA) |
393 amino acids |
Molecular Weight |
44 kDa |
NCBI Gene Id |
7157 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Alias Symbols |
P53, BCC7, LFS1, BMFS5, TRP53 |
Peptide Sequence |
Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Boehme,K.A., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (22), 7785-7790 |
Description of Target |
TP53 acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. This gene encodes tumor protein p53, which responds to diverse cellular stresses to regulate target genes that induce cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. p53 protein is expressed at low level in normal cells and at a high level in a variety of transformed cell lines, where it's believed to contribute to transformation and malignancy. p53 is a DNA-binding protein containing transcription activation, DNA-binding, and oligomerization domains. It is postulated to bind to a p53-binding site and activate expression of downstream genes that inhibit growth and/or invasion, and thus function as a tumor suppressor. Mutants of p53 that frequently occur in a number of different human cancers fail to bind the consensus DNA binding site, and hence cause the loss of tumor suppressor activity. Alterations of this gene occur not only as somatic mutations in human malignancies, but also as germline mutations in some cancer-prone families with Li-Fraumeni syndrome. Multiple p53 variants due to alternative promoters and multiple alternative splicing have been found. These variants encode distinct isoforms, which can regulate p53 transcriptional activity. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
|
Datasheets/Manuals |
Printable datasheet for anti-TP53 (ARP30370_P050) antibody |
Blocking Peptide |
For anti-TP53 (ARP30370_P050) antibody is Catalog # AAP30370 (Previous Catalog # AAPS08808) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TP53 |
Uniprot ID |
P04637 |
Protein Name |
Cellular tumor antigen p53 |
Sample Type Confirmation |
TP53 is strongly supported by BioGPS gene expression data to be expressed in DU145, HEK293T TP53 is supported by BioGPS gene expression data to be expressed in HeLa |
Protein Accession # |
NP_000537 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_000546 |
Tested Species Reactivity |
Human |
Gene Symbol |
TP53 |
Predicted Species Reactivity |
Human |
Application |
ELISA, WB, CHIP |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human 293T
| WB Suggested Anti-TP53 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T.TP53 is strongly supported by BioGPS gene expression data to be expressed in HEK293T |
| Image 2 | Human U2OS, PLKO
| U20S (p53+) cells were treated with 0.5 uM Doxorubicin for 14 hrs to induce DNA damage and hence activate p53. In parallel, PLKO cells (U2OS cells with stable shRNA-mediated knockdown of p53) were treated similarly and were used as negative control. Thedata for p21 promoter were normalised to actin (control for non-specific binding of DNA to the antibodies). |
|
|