| Product Number |
ARP30180_P050 |
| Product Page |
www.avivasysbio.com/fkbp4-antibody-c-terminal-region-arp30180-p050.html |
| Name |
FKBP4 Antibody - C-terminal region (ARP30180_P050) |
| Protein Size (# AA) |
459 amino acids |
| Molecular Weight |
52kDa |
| NCBI Gene Id |
2288 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
FK506 binding protein 4, 59kDa |
| Alias Symbols |
HBI, p52, Hsp56, FKBP51, FKBP52, FKBP59, PPIase |
| Peptide Sequence |
Synthetic peptide located within the following region: ANMFERLAEEENKAKAEASSGDHPTDTEMKEEQKSNTAGSQSQVETEA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ruan,B., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (1), 33-38 |
| Description of Target |
FKBP4 is a component of unactivated mammalian steroid receptor complexes that sediment at 8-10 S. It may have a rotamase activity. FKBP4 may play a role in the intracellular trafficking of heterooligomeric forms of steroid hormone receptors.The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It has high structural and functional similarity to FK506-binding protein 1A (FKBP1A), but unlike FKBP1A, this protein does not have immunosuppressant activity when complexed with FK506. It interacts with interferon regulatory factor-4 and plays an important role in immunoregulatory gene expression in B and T lymphocytes. This encoded protein is known to associate with phytanoyl-CoA alpha-hydroxylase. It can also associate with two heat shock proteins (hsp90 and hsp70) and thus may play a role in the intracellular trafficking of hetero-oligomeric forms of the steroid hormone receptors. This protein correlates strongly with adeno-associated virus type 2 vectors (AAV) resulting in a significant increase in AAV-mediated transgene expression in human cell lines. Thus this encoded protein is thought to have important implications for the optimal use of AAV vectors in human gene therapy. This gene has been found to have multiple polyadenylation sites. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Protein Interactions |
HSP90AB1; HSP90AA1; RPS10-NUDT3; CDC37L1; LSM7; CACYBP; CHORDC1; GLMN; CDC37; SUGT1; USP19; PTGES3; AHSA1; UBC; MDM2; MGEA5; TPM3; MCM4; MCM3; SQSTM1; Nr3c1; S100A6; S100A2; S100A1; gag-pol; VCAM1; TAF9; SNCA; SARDH; UBD; PGR; NR3C2; AR; CDK2; SIRT7; SH3B |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-FKBP4 (ARP30180_P050) antibody |
| Blocking Peptide |
For anti-FKBP4 (ARP30180_P050) antibody is Catalog # AAP30180 (Previous Catalog # AAPS08908) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human FKBP4 |
| Uniprot ID |
P30416 |
| Protein Name |
Peptidyl-prolyl cis-trans isomerase FKBP4 |
| Sample Type Confirmation |
FKBP4 is strongly supported by BioGPS gene expression data to be expressed in 721_B |
| Protein Accession # |
NP_002005 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_002014 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
FKBP4 |
| Predicted Species Reactivity |
Human, Pig |
| Application |
WB, IHC |
| Predicted Homology Based on Immunogen Sequence |
Human: 100%; Pig: 75% |
| Image 1 | Human 721_B
 | WB Suggested Anti-FKBP4 Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysateFKBP4 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells |
|
| Image 2 | Human Fetal Lung
 | Host: Rabbit
Target Name: FKBP4
Sample Type: Human Fetal Lung
Antibody Dilution: 1.0ug/ml |
|
| Image 3 | Human Liver Tissue
 | FKBP4 antibody - C-terminal region (ARP30180_P050)
Catalog Number: ARP30180_P050
Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue
Observed Staining: Cytoplasm in hepatocytes
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1/600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec |
|
