MXD3 Antibody - N-terminal region : HRP (ARP30089_T100-HRP)

Data Sheet
 
Product Number ARP30089_T100-HRP
Product Page www.avivasysbio.com/mxd3-antibody-n-terminal-region-hrp-arp30089-t100-hrp.html
Name MXD3 Antibody - N-terminal region : HRP (ARP30089_T100-HRP)
Protein Size (# AA) 206 amino acids
Molecular Weight 23kDa
Conjugation HRP: Horseradish Peroxidase
NCBI Gene Id 83463
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name MAX dimerization protein 3
Alias Symbols MYX, MAD3, BHLHC13
Peptide Sequence Synthetic peptide located within the following region: PIHRRKKRPPQAPGAQDSGRSVHNELEKRRRAQLKRCLERLKQQMPLGAD
Product Format Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Reference Suzuki,Y., Gene 200 (1-2), 149-156 (1997)
Description of Target MXD3 contains 1 basic helix-loop-helix (bHLH) domain. It is a transcriptional repressor and binds with MAX to form a sequence-specific DNA-binding protein complex which recognizes the core sequence 5'-CAC[GA]TG-3'. Antagonizes MYC transcriptional activity by competing for MAX and suppresses MYC dependent cell transformation.
Protein Interactions NOTCH2NL; KRTAP10-7; UBC; NFKB1; MAGEA11; MAX; SIN3A; SMC3;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-MXD3 (ARP30089_T100-HRP) antibody
Blocking Peptide For anti-MXD3 (ARP30089_T100-HRP) antibody is Catalog # AAP30089 (Previous Catalog # AAPH00265)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MXD3
Uniprot ID Q9BW11
Protein Name Max dimerization protein 3
Protein Accession # NP_112590
Nucleotide Accession # NM_031300
Gene Symbol MXD3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 85%; Pig: 86%; Rabbit: 86%; Rat: 93%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com