GLIS2 Antibody - N-terminal region (ARP30036_T100)

Data Sheet
 
Product Number ARP30036_T100
Product Page www.avivasysbio.com/glis2-antibody-n-terminal-region-arp30036-t100.html
Name GLIS2 Antibody - N-terminal region (ARP30036_T100)
Protein Size (# AA) 524 amino acids
Molecular Weight 56 kDa
NCBI Gene Id 84662
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name GLIS family zinc finger 2
Alias Symbols NKL, NPHP7
Peptide Sequence Synthetic peptide located within the following region: LSPPSGLDSPNGSSSLSPERQGNGDLPPVPSASDFQPLRYLDGVPSSFQF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kim,Y.S., et al., (2003) Nucleic Acids Res. 31 (19), 5513-5525
Description of Target Members of the Kruppel-like zinc finger protein family, such as GLIS2, function as activators and/or repressors of gene transcription.[supplied by OMIM].
Protein Interactions TRIM32; UBC; PML; BBS2; BBS1; WNK1; XAB2; GPSM2; CPSF1; RBFOX2; SPECC1L; U2AF2; CTNNB1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
Datasheets/Manuals Printable datasheet for anti-GLIS2 (ARP30036_T100) antibody
Blocking Peptide For anti-GLIS2 (ARP30036_T100) antibody is Catalog # AAP30036 (Previous Catalog # AAPH00212)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GLIS2
Uniprot ID Q9BZE0
Protein Name Zinc finger protein GLIS2
Protein Accession # NP_115964
Purification Protein A purified
Nucleotide Accession # NM_032575
Tested Species Reactivity Human
Gene Symbol GLIS2
Predicted Species Reactivity Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 92%; Guinea Pig: 86%; Horse: 77%; Human: 100%; Mouse: 83%; Rabbit: 85%; Rat: 92%
Image 1
GLIS2 Antibody - N-terminal region (ARP30036_T100)
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 7 ug/mL of the antibody was used in this experiment.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com