INSM2 Antibody - middle region (ARP30029_P050)

Data Sheet
 
Product Number ARP30029_P050
Product Page www.avivasysbio.com/insm2-antibody-middle-region-arp30029-p050.html
Name INSM2 Antibody - middle region (ARP30029_P050)
Protein Size (# AA) 566 amino acids
Molecular Weight 59kDa
NCBI Gene Id 84684
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Insulinoma-associated 2
Alias Symbols IA6, IA-6, mlt1
Peptide Sequence Synthetic peptide located within the following region: GIKKPKAMRKLSFADEVTTSPVLGLKIKEEEPGAPSRGLGGSRTPLGEFI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903
Description of Target The function of INSM2 remains unknown.
Protein Interactions ZSCAN1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-INSM2 (ARP30029_P050) antibody
Blocking Peptide For anti-INSM2 (ARP30029_P050) antibody is Catalog # AAP30029 (Previous Catalog # AAPH00205)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human INSM2
Uniprot ID Q96T92
Protein Name Insulinoma-associated protein 2
Protein Accession # NP_115983
Purification Affinity Purified
Nucleotide Accession # NM_032594
Tested Species Reactivity Human
Gene Symbol INSM2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 100%
Image 1
Human THP-1
WB Suggested Anti-INSM2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: THP-1 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com