| Product Number |
ARP30014_P050 |
| Product Page |
www.avivasysbio.com/znf341-antibody-middle-region-arp30014-p050.html |
| Name |
ZNF341 Antibody - middle region (ARP30014_P050) |
| Protein Size (# AA) |
847 amino acids |
| Molecular Weight |
92kDa |
| NCBI Gene Id |
84905 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 341 |
| Alias Symbols |
HIES3 |
| Peptide Sequence |
Synthetic peptide located within the following region: GEEEGDKPESKQVVLIDSSYLCQFCPSKFSTYFQLKSHMTQHKNEQVYKC |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45 |
| Description of Target |
The ZNF341 gene is located on chromosome 20. |
| Protein Interactions |
CENPP; KLHL38; WDYHV1; MAGEB4; CSTF2; ARNT2; PRPF40A; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF341 (ARP30014_P050) antibody |
| Blocking Peptide |
For anti-ZNF341 (ARP30014_P050) antibody is Catalog # AAP30014 (Previous Catalog # AAPH00114) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZNF341 |
| Uniprot ID |
Q9BYN7 |
| Protein Name |
Zinc finger protein 341 |
| Protein Accession # |
NP_116208 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_032819 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF341 |
| Predicted Species Reactivity |
Human, Mouse, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 93%; Rabbit: 86% |
| Image 1 | Human HepG2
 | WB Suggested Anti-ZNF341 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate |
| | Image 2 | Human Intestine
 | Rabbit Anti-ZNF341 Antibody
Catalog Number: ARP30014
Paraffin Embedded Tissue: Human Intestine
Cellular Data: Epithelial cells of intestinal villas
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
|
