| Sku |
AAPP47621 |
| Price |
$99.00 |
| Name |
NARS Peptide - N-terminal region (AAPP47621) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
NARS |
| Alias symbols |
ASNRS, NARS1 |
| Gene id |
4677 |
| Description of target |
Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. Asparaginyl-tRNA synthetase is localized to the cytoplasm and belongs to the class II family of tRNA synthetases. The N-terminal domain represents the signature sequence for the eukaryotic asparaginyl-tRNA synthetases. |
| Swissprot id |
O43776 |
| Protein accession num |
NP_004530 |
| Nucleotide accession num |
NM_004539 |
| Protein size |
548 amino acids |
| Molecular weight |
60kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
TIYVDSQKENERWNVISKSQLKNIKKMWHREQMKSESREKKEAEDSLRRE |
| Partner proteins |
ATXN1,LSM1,LSM1 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-NARS Antibody (ARP61484_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
