CRY2 Peptide - N-terminal region (AAPP14342)

Data Sheet
 
Sku AAPP14342
Price $99.00
Name CRY2 Peptide - N-terminal region (AAPP14342)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene CRY2
Alias symbols FLJ10332, HCRY2, KIAA0658, PHLL2
Gene id 1408
Description of target CRY2 is a blue light-dependent regulator of the circadian feedback loop.CRY2 inhibits CLOCK|NPAS2-ARNTL E box-mediated transcription. CRY2 acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity.CRY2 has no photolyase activity.CRY2 is capable of translocating circadian clock core proteins such as PER proteins to the nucleus.CRY2 may inhibit CLOCK|NPAS2-ARNTL transcriptional activity through stabilizing the unphosphorylated form of ARNTL.
Swissprot id Q49AN0
Protein accession num NP_066940
Nucleotide accession num NM_021117
Protein size 593 amino acids
Molecular weight 67kDa
Species reactivity Human
Application WB
Peptide sequence IELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDE
Partner proteins PER1,PER2,PER3,PPP5C,CRY2,PER2,PPP5C,TIMELESS,TTC1
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-CRY2 Antibody(ARP52398_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com