| Sku |
AAP97372 |
| Price |
99 |
| Name |
CUX1 Peptide - middle region (AAP97372) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
CUX1 |
| Alias symbols |
CDP, Cux, Cutl1, Cux-1 |
| Gene id |
13047 |
| Description of target |
Probably has a broad role in mammalian development as a repressor of developmentally regulated gene expression. May act by preventing binding of positively-activing CCAAT factors to promoters. Component of nf-munr repressor; binds to the matrix attachment regions (MARs) (5' and 3') of the immunoglobulin heavy chain enhancer. Represses T-cell receptor (TCR) beta enhancer function by binding to MARbeta, an ATC-rich DNA sequence located upstream of the TCR beta enhancer. Binds to the TH enhancer; may require the basic helix-loop-helix protein TCF4 as a coactivator. |
| Swissprot id |
P53564-5 |
| Protein accession num |
NP_001278162.1 |
| Nucleotide accession num |
NM_001291233.1 |
| Protein size |
460 amino acids |
| Molecular weight |
50 kDa |
| Species reactivity |
Mouse |
| Peptide sequence |
Synthetic peptide located within the following region: DPNNVEKLMDMKRMEKKAYMKRRHSSVSDSQPCEPPSVGIDYSQGASPQP |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Description |
This is a synthetic peptide designed for use in combination with anti- CUX1 Antibody (ARP97372_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
