PC Peptide - middle region (AAP97247)

Data Sheet
 
Sku AAP97247
Price 99
Name PC Peptide - middle region (AAP97247)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene PC
Alias symbols Pcx
Gene id 25104
Description of target biotin-containing enzyme that catalyses the carboxylation of pyruvate to form oxaloacetate.
Swissprot id P52873
Protein accession num NP_036876
Nucleotide accession num NM_012744.2
Protein size 1178 amino acids
Molecular weight 129 kDa
Species reactivity Rat
Peptide sequence Synthetic peptide located within the following region: EAAISYTGDVADPSRTKYSLEYYMGLAEELVRAGTHILCIKDMAGLLKPA
Quality control The peptide is characterized by mass spectroscopy
Description This is a synthetic peptide designed for use in combination with anti- PC Antibody (ARP97247_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com