Sku |
AAP96867 |
Price |
99 |
Name |
GTPBP3 Peptide - middle region (AAP96867) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
GTPBP3 |
Alias symbols |
tRNA modification GTPase GTPBP3, mitochondrial |
Gene id |
84705 |
Description of target |
This locus encodes a GTP-binding protein. The encoded protein is localized to the mitochondria and may play a role in mitochondrial tRNA modification. Polymorphisms at this locus may be associated with severity of aminoglycoside-induced deafness, a disease associated with a mutation in the 12S rRNA. Alternatively spliced transcript variants encoding different isoforms have been described. |
Swissprot id |
Q969Y2-3 |
Protein accession num |
NP_001122327.1 |
Nucleotide accession num |
NM_001128855.2 |
Protein size |
471 amino acids |
Molecular weight |
51 kDa |
Species reactivity |
Human |
Peptide sequence |
Synthetic peptide located within the following region: LREGVGPVEQEGVRRARERLEQADLILAMLDASDLASPSSCNFLATVVAS |
Quality control |
The peptide is characterized by mass spectroscopy |
Description |
This is a synthetic peptide designed for use in combination with anti- GTPBP3 Antibody (ARP96867_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |