GTPBP3 Peptide - middle region (AAP96867)

Data Sheet
 
Sku AAP96867
Price 99
Name GTPBP3 Peptide - middle region (AAP96867)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene GTPBP3
Alias symbols tRNA modification GTPase GTPBP3, mitochondrial
Gene id 84705
Description of target This locus encodes a GTP-binding protein. The encoded protein is localized to the mitochondria and may play a role in mitochondrial tRNA modification. Polymorphisms at this locus may be associated with severity of aminoglycoside-induced deafness, a disease associated with a mutation in the 12S rRNA. Alternatively spliced transcript variants encoding different isoforms have been described.
Swissprot id Q969Y2-3
Protein accession num NP_001122327.1
Nucleotide accession num NM_001128855.2
Protein size 471 amino acids
Molecular weight 51 kDa
Species reactivity Human
Peptide sequence Synthetic peptide located within the following region: LREGVGPVEQEGVRRARERLEQADLILAMLDASDLASPSSCNFLATVVAS
Quality control The peptide is characterized by mass spectroscopy
Description This is a synthetic peptide designed for use in combination with anti- GTPBP3 Antibody (ARP96867_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com