| Sku |
AAP89513 |
| Price |
99 |
| Name |
KLF6 Peptide - middle region (AAP89513) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
KLF6 |
| Alias symbols |
FM2, FM6, Zf9, BCD1, CPBP, Copeb, C86813, R75280, Ierepo1, Ierepo3, AI448727 |
| Gene id |
23849 |
| Description of target |
Transcriptional activator. Binds a GC box motif. Could play a role in B-cell growth and development (By similarity). |
| Swissprot id |
O08584 |
| Protein size |
283 amino acids |
| Molecular weight |
31 kDa |
| Species reactivity |
Mouse |
| Peptide sequence |
Synthetic peptide located within the following region: LKISSSPPEDSLISSSFNYNLETNSLNSDVSSESSDSSEELSPTTKFTSD |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Description |
This is a synthetic peptide designed for use in combination with anti- KLF6 Antibody (ARP89513_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
