JUNB Peptide - middle region (AAP89035)

Data Sheet
 
Sku AAP89035
Price 99
Name JUNB Peptide - middle region (AAP89035)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene JUNB
Gene id 16477
Description of target Transcription factor involved in regulating gene activity following the primary growth factor response. Binds to the DNA sequence 5'-TGA[CG]TCA-3'.
Swissprot id P09450
Protein accession num NP_032442.1
Nucleotide accession num NM_008416.3
Protein size 344 amino acids
Molecular weight 37 kDa
Species reactivity Mouse
Peptide sequence Synthetic peptide located within the following region: VPNSNGVITTTPTPPGQYFYPRGGGSGGGTGGGVTEEQEGFADGFVKALD
Quality control The peptide is characterized by mass spectroscopy
Description This is a synthetic peptide designed for use in combination with anti- JUNB Antibody (ARP89035_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com