GNL3 Peptide - C-terminal region (AAP88590)

Data Sheet
 
Sku AAP88590
Price 99
Name GNL3 Peptide - C-terminal region (AAP88590)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene GNL3
Alias symbols NS, E2IG3, NNP47, C77032
Gene id 26354
Description of target The protein encoded by this gene may interact with p53 and may be involved in tumorigenesis. The encoded protein also appears to be important for stem cell proliferation. This protein is found in both the nucleus and nucleolus. Three transcript variants encoding two different isoforms have been found for this gene.
Swissprot id Q9BVP2
Protein accession num NP_055181.3
Nucleotide accession num NM_014366.4
Protein size 549 amino acids
Molecular weight 62 kDa
Species reactivity Human
Peptide sequence Synthetic peptide located within the following region: LFQSSGLTNGIIEEKDIHEELPKRKERKQEEREDDKDSDQETVDEEVDEN
Quality control The peptide is characterized by mass spectroscopy
Description This is a synthetic peptide designed for use in combination with anti- GNL3 Antibody (ARP88590_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com