| Sku |
AAP88211 |
| Price |
99 |
| Name |
SNAPIN Peptide - C-terminal region (AAP88211) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
SNAPIN |
| Alias symbols |
BLOS7, SNAPAP, BLOC1S7 |
| Gene id |
23557 |
| Description of target |
The protein encoded by this gene is a coiled-coil-forming protein that associates with the SNARE (soluble N-ethylmaleimide-sensitive fusion protein attachment protein receptor) complex of proteins and the BLOC-1 (biogenesis of lysosome-related organelles) complex. Biochemical studies have identified additional binding partners. As part of the SNARE complex, it is required for vesicle docking and fusion and regulates neurotransmitter release. The BLOC-1 complex is required for the biogenesis of specialized organelles such as melanosomes and platelet dense granules. Mutations in gene products that form the BLOC-1 complex have been identified in mouse strains that are models of Hermansky-Pudlak syndrome. Alternative splicing results in multiple transcript variants. |
| Swissprot id |
O95295 |
| Protein accession num |
NP_036569.1 |
| Nucleotide accession num |
NM_012437.5 |
| Protein size |
136 amino acids |
| Molecular weight |
14 kDa |
| Species reactivity |
Human |
| Peptide sequence |
Synthetic peptide located within the following region: LLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSP |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Description |
This is a synthetic peptide designed for use in combination with anti- SNAPIN Antibody (ARP88211_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
