| Sku |
AAP88193 |
| Price |
99 |
| Name |
PPARGC1B Peptide - N-terminal region (AAP88193) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
PPARGC1B |
| Alias symbols |
PERC, ERRL1, PGC1B, PGC-1(beta) |
| Gene id |
133522 |
| Description of target |
The protein encoded by this gene stimulates the activity of several transcription factors and nuclear receptors, including estrogen receptor alpha, nuclear respiratory factor 1, and glucocorticoid receptor. The encoded protein may be involved in fat oxidation, non-oxidative glucose metabolism, and the regulation of energy expenditure. This protein is downregulated in prediabetic and type 2 diabetes mellitus patients. Certain allelic variations in this gene increase the risk of the development of obesity. Three transcript variants encoding different isoforms have been found for this gene. |
| Swissprot id |
Q86YN6 |
| Protein accession num |
NP_001166169.1 |
| Nucleotide accession num |
NM_001172698.1 |
| Protein size |
1023 amino acids |
| Molecular weight |
112 kDa |
| Species reactivity |
Human |
| Peptide sequence |
Synthetic peptide located within the following region: LSQLDASDFDSATCFGELQWCPENSETEPNQYSPDDSELFQIDSENEALL |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Description |
This is a synthetic peptide designed for use in combination with anti- PPARGC1B Antibody (ARP88193_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
